KEGG   Bifidobacterium dentium Bd1: BDP_1832Help
Entry
BDP_1832          CDS       T01143                                 

Definition
(GenBank) Glycosyltransferase, family 2
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2094216..2095178)
Genome map
AA seq 320 aa AA seqDB search
MSEQPLVSVIVPVYSVERSLGRCMHSLVGQTYRHLEIILVDDGSPDDCPRLCDAWAGQDD
RIRVIHKPNGGLSDARNAGLDAMRGDFVAFVDSDDYVEPDYVNRLYAGVSDADMSMCSII
CEDSNGKAWQGNEPITDERIAVSSEEYLRRALLDWRLVVAWNKLYAASIWNQLRFPVGCI
HEDEYVLHQVVDRCKSINVLPDELYHYVSTDSSITHSGFSIRNLDRLEALVRRLEYCVSK
NYRQCAALTFSKFIEDLDFASGLDWSDRKIHARLGEIFGQLRRVPLSAGLFLSSKRRMQF
FGLRFAPFLTEWILKKAKHL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaacaaccgttggtcagtgttattgttcccgtgtatagcgtggaacgatcattg
ggccgttgcatgcacagcttagtaggacaaacctatcggcatcttgaaataattcttgtc
gacgatggttccccggatgactgcccgcggctgtgcgacgcatgggccgggcaggatgat
cgtatccgggtgattcacaaacccaatggcggtttgtccgatgccaggaacgccggcttg
gacgccatgcgtggcgatttcgtcgcgttcgtggacagcgacgattacgtggaaccggat
tatgtgaacaggctgtatgccggcgtctccgatgccgacatgtccatgtgctccatcatc
tgtgaggattccaatggaaaggcgtggcagggaaacgaaccgattacggacgaacggatc
gctgtgtcttctgaggaatatctgcgccgcgccttgctggactggcggctggtggtcgct
tggaacaaactgtatgcggcttcgatttggaaccagctacgcttcccggtcggctgcatc
catgaggacgaatatgtgctgcaccaggtggtggaccgatgcaagagcatcaatgtattg
ccggacgagctataccactatgtatccacggacagtagcattacgcacagtggtttcagc
atcaggaatcttgaccgtttggaggccttggtgcggaggctggagtattgcgtaagcaaa
aactaccggcaatgtgcggccttgaccttcagcaagttcatcgaagatctcgatttcgca
tccgggctggactggtcggatcggaaaatccatgctaggcttggcgagatcttcggacag
ttgagacgcgtgccgctttccgccgggttattcctgtcctccaaacggcgcatgcagttc
tttggcctacggtttgctccgttccttacggaatggatattgaagaaagccaagcatcta
tga

DBGET integrated database retrieval system