KEGG   Bifidobacterium dentium Bd1: BDP_1838Help
Entry
BDP_1838          CDS       T01143                                 

Definition
(GenBank) Glycosyltransferase, family 14
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2100437..2101315)
Genome map
AA seq 292 aa AA seqDB search
MITETRSHSFVVTAYKDPDNLYRLVNRLRADFNVFVHIDKSSTALGEGDVKQLEELPGVH
AVSVYDITWGSYKHLLALIDLVREACEWTADDGYLHLISGQDYPVYGNQYIKDFFTGNTK
IYMDYRDLSHMENHQKKFFQYKNHLWRFNYWNKIVHAVRNADNWVQRTFGLLNDNIGGIH
DIAQGLVWMSMPEKPMRYVLDYIQNNPKFMHDVYRLQVPEEFVFQTILGVSHFKDDIAPN
NLRYSDWHRRNGSLPAYLDESDYEKVLESGCLFARKIDSKISGNLIRRFEAN
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgattaccgaaaccagaagccattcatttgtcgtgaccgcatacaaagatccagataat
ctctatcgcttagtgaatcggctgcgtgccgatttcaacgtgttcgttcacatcgataag
tcgtcgactgcgctgggtgagggtgatgtgaagcagttggaggaattgcctggagtccat
gccgtgtccgtatatgacattacttggggaagctataagcatttgctggccttgattgat
ctcgtgcgcgaggcatgcgagtggacggcggatgacggctatctgcatttgatttcggga
caggattatcccgtgtatggcaatcaatatattaaggatttctttacaggaaatacgaaa
atctatatggattatcgtgacctgtctcatatggagaatcatcagaagaaatttttccaa
tacaagaatcatctatggcgattcaattactggaacaagatcgtgcatgccgtaagaaat
gcggacaattgggtgcagcgtacgtttggactattgaacgataatatcggtggtattcat
gatatagcgcaggggctggtatggatgtccatgccggaaaaaccgatgcgatatgtgctt
gattatattcagaataatccaaagttcatgcatgacgtgtaccggttgcaggtacctgaa
gaatttgttttccagacgattctgggtgtgtcgcattttaaggacgatattgccccaaat
aatctgcgctactctgattggcacaggcgcaatggcagtttgcccgcgtatctggacgag
agtgattatgaaaaggttcttgagtctggatgcctgttcgccagaaaaatcgattcaaaa
atatctgggaacctgattcgtcgttttgaagctaactga

DBGET integrated database retrieval system