KEGG   Bifidobacterium dentium Bd1: BDP_1844Help
Entry
BDP_1844          CDS       T01143                                 

Definition
(GenBank) Glycosyl transferase, family 2
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4 Glyco_trans_2_3
Motif
Other DBs
NCBI-ProteinID: ADB10427
UniProt: D2Q662
Position
complement(2105496..2106524)
Genome map
AA seq 342 aa AA seqDB search
MTGNIEISPLPSVSIIVPVRNAKNYLDACVDSLRSQIYPKLDIILVDDGSTDGSSELCDA
AAERDQRIRVIHQTCKGVSEARNAGLDTATGEYVLFVDSDDQLRVDAVMGALRCAHEHSA
DMVVCGYDVVEELADGGTVSQGSRTVRQEEVIDTRQRHEKDVANRLCAFDNDELLYQCWG
KLYRRATIGDLRFARDAAFGEDTVFVLELLARGIRVVFSPQCSYLYLQHADSLVRGFRSG
KTHDLEYSHGKHLAFYRDMPISDANRRGLYLRMANDTLWAVYDAGKAAGSVDETELLRFV
RCAASSPYRGVYLREIRRVAVDRRTKVAFVVNMPFLWKLYWR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaatattgagatatctcccttaccctcagtaagcattatcgtgccggtgcgg
aacgcgaagaattacctcgatgcttgtgtggatagcttgcgctcgcagatctacccgaag
cttgacatcatactggttgatgatgggtctacggacggatcgtcggaactctgtgatgcg
gccgcggagcgtgatcagcgtattcgtgtgattcatcaaacctgtaaaggagtgtccgaa
gcacgtaacgctggtttggacactgctaccggcgagtatgtattgttcgtcgatagcgat
gatcagttgcgtgtagatgcggtcatgggggctttgagatgtgcgcacgagcattctgcg
gatatggtggtgtgcggatacgacgttgtcgaagagcttgccgatggcggcactgtcagc
caggggagcaggactgtgcgtcaggaagaagtaatcgacactcgccaacgccatgaaaaa
gatgtggcgaatcggttatgcgcttttgataatgatgagttgctctatcaatgctgggga
aaactgtatcggcgtgcgaccatcggagacttacgatttgctcgtgatgctgcgtttggc
gaggatacggtatttgttttggaacttctcgctcgtggtattcgtgtggttttctctccg
caatgttcgtatctgtatctacagcatgcggacagtttggttcgtggatttcgttcggga
aagacacacgatttggaatattcccatggcaagcatttggcgttttatcgggacatgccg
atcagtgatgcgaatagacgtggtctatatctgcgtatggcaaacgacacgttatgggcg
gtctatgatgccggcaaagcagcagggagcgttgacgaaacggagctattgcgctttgtc
cgttgtgcggcttcgtcaccgtatcgaggtgtgtacttgcgggaaatcagacgcgtggct
gtagaccgacgtaccaaagtcgcgttcgttgtaaatatgccgttcttgtggaaactgtat
tggaggtga

DBGET integrated database retrieval system