KEGG   Bifidobacterium dentium Bd1: BDP_1845Help
Entry
BDP_1845          CDS       T01143                                 

Definition
(GenBank) Glycosyltransferase group 1
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2106521..2107666)
Genome map
AA seq 381 aa AA seqDB search
MESQPIHILQWGMTTSLGGIETFIMNVYRHMDRTKVQFDFLQDHHDGPLHFEDEIRDMGG
TIYRELVPQRDSLIRSRTCLPKFFRQHPEIVGVHMHANFPYALPLKYAQRAGIGLRVLHS
HNIEEYQHHENPLRALLWDMRGRAIAKDIDRYPTHYFACSDLAANFMFPDKPYTWIRNGI
DSARFAYNIAVRKRLRSELGIAEHTSVIGFCGGLRPQKNPMFLMRMFERYHVIHPESVLI
LVGDGLLREEIERSVVEMNLEDCVHLLGQRADVAELYQAMDAFVLPSVAEGLGIVYIEAQ
CAGLPCLGSAGVVPEAVRVCDLMHFERLENGPEIWAERLNDMLRNAPERKNRTAEVRSAG
YEMSDVAARLQEFYIRKGGRS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggaatcacagcctattcatatcctccaatggggaatgaccaccagtctgggtggaatc
gagaccttcatcatgaacgtgtaccgtcatatggatcggaccaaggtgcagttcgatttt
ctgcaggaccatcatgacggtccactgcatttcgaagatgagattcgagacatgggggga
accatatatcgggaactcgttccacagcgagattccctgatccgttcacgtacgtgtctg
ccgaagttcttccgacagcatccggaaatcgtgggggtccacatgcatgcgaactttccc
tatgcgttgccattgaagtatgcgcagcgcgcaggtatcggattacgcgttctgcattcc
cataacattgaggaataccagcatcatgaaaacccgctacgggcgttgctgtgggacatg
cgaggcagggccattgccaaagatattgaccgataccccacccattatttcgcttgttcg
gatttggcggcgaattttatgtttcctgataagccctacacctggattcgcaatggcata
gacagcgcgcgattcgcctataacatcgcagtcaggaaaaggctccgcagtgagttggga
atcgccgaacacacttcagtcatcggattctgcggtggattgcgaccgcagaagaacccg
atgttcctgatgcgtatgttcgagcgctaccatgtcattcatccggaatctgtgttgatt
ctagtgggcgatggtttattgcgggaggagatcgaacgtagcgtcgtcgagatgaatttg
gaagactgtgtgcatttgcttgggcagcgtgccgacgtcgcagaactctaccaggccatg
gatgctttcgtgcttccgtcggtggccgaaggactgggcatcgtgtatatcgaagcgcaa
tgcgccggtttgccttgccttggttccgccggtgtagtgccggaagcggttcgggtgtgt
gatcttatgcatttcgaacgattggaaaacggaccagagatttgggcggagcgacttaac
gacatgctcaggaatgcgcctgaacggaagaatcgaactgccgaggtgcggtccgcagga
tacgaaatgtctgatgtagccgcccgactacaggaattctacataagaaaaggaggtaga
tcatga

DBGET integrated database retrieval system