KEGG   Bifidobacterium dentium Bd1: BDP_1850Help
Entry
BDP_1850          CDS       T01143                                 

Gene name
wefN
Definition
(GenBank) Glycosyl transferase group 1 WefN
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2110823..2111923)
Genome map
AA seq 366 aa AA seqDB search
MHIGFFSGDITRSGGTENVSIMIANELLARTDYEISFVSLFEEHDSPFFSIDPSIRRFEL
YPTVTHGMQHYFDTCRRLRNIVDNQHIDVLIDIDGILDMYSLPVKHSTGVKVVSWEHFNY
LQNPGVPYRKLTRRWAARRADAIVTLTETDRKLYEGNLKLKCPIMAIANPMGTPTEVSYD
ADSRLILSSGRLTYQKGFDLLVKVASKVLPNHPDWQWMVLGEGEDRPVLEQMIHDASLDN
QLVLEGRVDDMDSYYRRSAMFVMTSRFEGLPMVLLEAKAHRLPLISFDCPTGPSEVIEDG
VNGAVVPLGDIDTMAATINTLIDDRAKRVEYSSMSGSNAERYDMATIFDGWRWLLRSFDS
SGTRAD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcatattgggtttttctccggcgacatcacccgatcaggtggcacggaaaacgtgtcc
atcatgattgccaacgagcttttggcacggaccgattacgagatttcgttcgttagcttg
ttcgaggagcacgatagtccgtttttctcgattgatccgagtatccgtcgatttgagctg
tatccgacagtcacgcatggcatgcaacactatttcgatacctgcagacgattgcggaac
attgttgataaccagcatatcgatgtgttgattgacattgacggtatcttggatatgtac
tcattaccggtcaagcatagtaccggcgtgaaggtggtgtcatgggaacacttcaattac
ctacagaatcccggagtgccttaccgtaagctgacccgccgttgggcggcacgacgtgcg
gatgccatcgtgacattgaccgaaaccgacagaaagctttatgaaggcaacctcaagctg
aaatgtccgatcatggcgattgcgaatcctatgggaacccctaccgaggtttcctatgat
gctgactcccgcctgatcctcagctccggacggctgacctaccagaaaggcttcgatttg
ctggtcaaggttgcgagcaaggttttgccgaatcatccagattggcagtggatggttctc
ggagaaggcgaggataggcccgtcctagagcaaatgattcacgatgcgagcttggataac
cagctggttcttgagggacgggttgacgacatggactcatattaccgacggtctgccatg
ttcgtgatgacatcccgttttgaaggattgccgatggtactgcttgaggccaaggcgcat
cgtctgccgctgataagtttcgattgtccaacaggcccatcggaagtcattgaagatgga
gtcaacggtgcggtcgtgccgttgggggacattgacaccatggctgcaaccatcaacaca
ctgattgatgacagggccaagcgtgtcgaatattcatctatgagcggcagtaatgccgaa
cgatatgatatggcgacgatttttgatggctggcgatggctgttgcgttcatttgattcg
agtggaacgagggctgactga

DBGET integrated database retrieval system