KEGG   Bifidobacterium dentium Bd1: BDP_1862Help
Entry
BDP_1862          CDS       T01143                                 

Gene name
rmlB
Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  
dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Acarbose and validamycin biosynthesis
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BDP_1862 (rmlB)
   01055 Biosynthesis of vancomycin group antibiotics
    BDP_1862 (rmlB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BDP_1862 (rmlB)
   00525 Acarbose and validamycin biosynthesis
    BDP_1862 (rmlB)
Enzymes [BR:bde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     BDP_1862 (rmlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2124630..2125616)
Genome map
AA seq 328 aa AA seqDB search
MTGGCGFIGSNFVHYVVNNHPDVHVTVLDKLTYAGNPENIAGLPEDRVELVVGDICDADL
LDRIVPGHDAIVHYAAESHNDNSIADPEPFLHTNVEGTFRLLEAVRKYGIRYHHVSTDEV
YGDLALDDPAKFTESTPYHPSSPYSSTKAASDLLVRAWTRTYGLRTTISNCSNNYGPYQH
VEKFIPRQITNILEGIRPKLYGKGENVRDWIHTEDHSSGVWTILTKGRIGETYLIGANGE
KNNITVLRMILKMMGQSEDAFDWVKDRPGHDRRYAIDSTKLQTELGWTPTHTDFESGLKQ
TIDWYTENRQWWEKTKAATEARYKAQGQ
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggtggctgcggcttcatcggatcgaacttcgtacattacgtggtcaataatcat
ccggatgtgcatgtcaccgtattggacaagctgacgtatgcaggcaatcctgagaacatc
gccggacttccggaagaccgcgtggagctggtcgtaggagatatctgcgatgcggatctg
ctggatcgcatcgtgccggggcacgacgcaatcgtgcattatgcggcggaatcgcacaac
gacaactccatcgccgatcccgagccgttcctgcacaccaatgtggagggcacgttccgt
ctgctcgaagcagtacgtaagtatggcatccgctaccatcacgtgagcaccgacgaggtg
tacggcgatctggcgctggatgatccggcgaagttcaccgagtccaccccataccatccg
agttcgccgtattcgtcgacgaaggcggcatccgacctgctggtgcgtgcatggactcgc
acgtacggactgcgcacgaccatttcgaactgctcgaacaactatggtccataccagcat
gttgagaagttcattccgcgtcagattacgaacattttggaaggcattcgcccgaagctg
tacggcaagggtgagaacgtgcgcgactggatccacaccgaagaccattcctccggcgtg
tggacgattctgaccaagggccgtattggcgaaacgtatctgatcggtgcgaacggcgaa
aagaacaacatcaccgtgttgcgcatgatcctgaagatgatggggcagagtgaggatgcg
ttcgattgggtgaaggaccgcccgggccacgaccgtcgttatgcgatcgattcgacgaag
ctgcagacggagttgggttggaccccgacccacacggattttgaatcgggactcaaacag
acgatcgattggtacaccgaaaaccgccagtggtgggagaagaccaaggccgcgaccgaa
gcgcgctacaaggcccaaggtcagtga

DBGET integrated database retrieval system