KEGG   Bifidobacterium dentium Bd1: BDP_1863Help
Entry
BDP_1863          CDS       T01143                                 

Definition
(GenBank) Hypothetical protein
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2126050..2127318
Genome map
AA seq 422 aa AA seqDB search
MQQLIANNRMFFMFMMLCCTLALFPGHTAAAWADAPPSAVAQVGGNTYASLQAAIQHVGN
GDSTITLLTDVTESIDFTLPDDADTAILNLDGHTLAASGGPAISIPADTTLTITGSGTVA
GGTESAILCWGTLIVENGTFTSSHTLMQFGEDSEGTAEAYLEHGTFSAPTIVERVGAADY
LGYVQIGGGMFHGTFPAGLDTLEILHGSFSDVSNLTSYLQLATGLAQAENGMYETTALRI
ISDIPQLELTASADTPEFTASSLLEQTGTRLNALADYRLDVDEVQLAALNKQIGLAAQAV
QGGTAFAGANQDVDITAARITSEKMQSRTATEDHIAAKVNVIIKPVEVPAQPEEPKEPTT
PPAEPSETPRETPAAPSQQSISRSMPKTGIVTLPMIFAAALLLSATAIVAVIRAPISRRK
LR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaattaatcgccaataatcgtatgtttttcatgttcatgatgctgtgttgcacc
cttgcgctgtttcctggccatacggctgccgcatgggccgacgctcctccatcagccgtg
gcacaggtcggcggcaacacatatgccagcctgcaggcggcaatccaacatgtcggcaac
ggcgactcgaccatcacattgcttacggacgtcaccgaaagcatcgatttcacgcttccc
gatgatgccgataccgcaattctgaatctcgacgggcatacgcttgcggcaagcggtggc
cccgcaatcagcattcccgccgataccacgctaaccataaccggctccggcaccgtcgcc
ggaggcaccgagtcggccatactgtgctggggcacgctgatcgtcgagaacggtacgttc
acgtccagccatacactgatgcaattcggcgaagacagcgaaggtacggcggaagcttac
ttggagcacggcacgttcagtgcgcccacgattgtcgaacgcgtcggtgctgccgattat
ctcggatacgtacaaatcggcggcggcatgtttcacggaacgtttcccgcaggattggat
acgctggagatactgcacggatcgttttccgacgtatcgaacctaacctcatatctgcaa
cttgccactggtctggctcaggcagagaacggcatgtacgaaaccactgcattgcgaatc
atcagcgatattccgcaactcgagctgaccgcgagcgcggatacgcccgagttcaccgcc
tccagcttgcttgaacagaccggtacgagattgaatgcactggctgattaccgacttgat
gtcgatgaggttcagcttgcggcgcttaataagcagatcggcttggctgcgcaagcggtg
caaggcggtaccgcattcgccggagcgaatcaggatgtcgacatcaccgcagcacgcatc
acctccgaaaagatgcagtcgcgcaccgcaacggaagaccatatcgccgccaaggtgaat
gtgattatcaagccggttgaagtaccagctcaacctgaggaacccaaggagccaacgact
cccccagccgaacccagtgaaacccctagggagacgcccgcagctccatctcaacaatcc
atcagccgcagcatgccgaaaaccggcatcgtcacgctcccgatgatctttgcggccgcg
cttcttttgtccgcaaccgcaatcgtcgctgtcatccgagctcccatttcccgccgaaag
ctgagatga

DBGET integrated database retrieval system