KEGG   Bifidobacterium dentium: BDP_2024Help
Entry
BDP_2024          CDS       T01143                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.56)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bde  Bifidobacterium dentium
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BDP_2024 (rbsK)
Enzymes [BR:bde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BDP_2024 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2293249..2294226)
Genome map
AA seq 325 aa AA seqDB search
MGAIEVLSALDRIHGTVSVIGSMNADYTVTAQRLPGPGETITGGPLQLLPGGKSGNQAAA
AARIGATVQMFGAVGSDSNAEFLLGALAEAGVNTTHVRRVLGPSGTTVITVDAAGENTIV
YSPGSNAQVTVDYVESVREALVRSSVLGLCLESPIETVTAAARICHEAGVKVLLNDSPFT
PSLPAELVAASDILLVNEHEMAQLLGIDEPEDDDWDAFDWGHVLDEMRSFGFDQAIVTLG
GDGSVVLDATAEEPIQRIAPVRVKAVDTTGCGDSFMGTVLAGLASGMSLSESAQLAAYVS
AYAATGYGAQASYGNAAQIREAFAE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgatcgaagtgctctctgcattggatcgaattcacggcacggtgtcggtgatc
ggctccatgaacgcggactacaccgttaccgcgcaacgactgccagggccgggggagacc
atcaccggtggcccgttgcagctgctgccgggtggtaaatcaggcaatcaggccgctgcg
gccgcgcgaatcggcgccaccgtgcagatgttcggcgcggttggctccgacagcaatgcc
gaattcctactcggcgctctggccgaggccggtgtgaacaccacgcatgtgcgccgcgtg
ctcggtccgagcggaaccacagtgatcaccgtggacgcggccggcgagaacaccatcgtg
tattctccgggctccaacgcacaggtgaccgtggattatgtggaatccgtacgcgaggcg
ctggtgcgttcttccgtgctcggcttgtgcctcgaaagtccgatcgagacggtgaccgcc
gccgcgcgcatctgccatgaggcgggtgtgaaggtgctgctcaacgattcgccgttcacg
ccgtcgttgcctgcggaactggtggcagcctccgacatcctgctcgtcaatgagcatgag
atggcgcagttgctcggcattgacgagcctgaggatgatgactgggacgctttcgactgg
ggtcatgttctggacgaaatgcggtcgttcggttttgatcaggcgatcgtgacattggga
ggcgacggttccgtggtgctcgacgccaccgcggaagagccgattcagcgcattgcaccg
gttcgcgtgaaggccgtcgacaccaccggttgcggcgattccttcatgggtaccgtgctg
gccggtctcgcctccggcatgtcgctgtccgagtccgcgcaacttgccgcgtacgtgtcc
gcctatgcggccacgggttacggtgcgcaggcttcttatggcaatgccgcgcagattcgc
gaggcattcgccgagtaa

DBGET integrated database retrieval system