KEGG   Bifidobacterium dentium: BDP_2147Help
Entry
BDP_2147          CDS       T01143                                 

Definition
endoglucanase family 5 (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bde  Bifidobacterium dentium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BDP_2147
Enzymes [BR:bde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BDP_2147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2454778..2455869)
Genome map
AA seq 363 aa AA seqDB search
MTTALEFVRGLGLGWNLGNTFDPVPLNDERNKTITTGGVWTPEDQQRLWFNKPFTRDCAF
FVKEAGFDTIRIPVTWKDWQDPYTGNVDPVWMAAVQEAVDWSYEAGLNVIVDVHHDGGNG
PFGWIRTASEDYPGVCSRFSALWHQIAERFRDYDHHLIFEGGNEICFPHAAHQDTAYELL
NRLNQLFVDIVRASGGNNADRFLLIPGYNTDTALTCDERFRLPEDTVDDHLIVSIHYYSP
AEFVLAEHDSDWCTPVDVWGSDEEVAAVEADFAKQKARFIDNGIPVIIGEYGLLTEPVDH
KDHDSNIKWLRTVIRCALTNGSCPILWDTSTKEMCFLNRETGRFFDPEVEAIYQEARTMS
VAQ
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggcacttgagtttgtgcgcggcctcggacttggctggaatctgggcaacacc
ttcgacccggttccgctgaacgacgaacgcaacaagacaatcactaccgggggagtgtgg
acgcccgaagaccagcagcgactgtggttcaacaagccgttcacccgcgactgcgccttc
ttcgtcaaggaagcgggtttcgacaccatccgcattcccgtcacgtggaaggattggcag
gacccgtacaccggcaacgtcgatccggtatggatggctgccgtgcaggaagccgtcgac
tggagttacgaggccggattgaacgtgatcgtcgacgtgcatcacgacggcggcaacggc
ccgttcggatggatccgtaccgccagcgaggactatccgggtgtctgctcgcgcttctcc
gcactatggcatcagattgcggaacgattccgtgattacgatcatcatctgattttcgaa
ggcggcaatgagatctgcttcccgcacgctgcccatcaggacaccgcctacgaactgctc
aaccggctgaatcaactgttcgtcgatatcgtgcgcgcctccggcggcaacaatgccgac
cgattcctcctgatccccggttacaacaccgacaccgcactgacctgcgacgaacgtttc
cgactgccggaagacacggtcgacgatcacctgatcgtgtcgatccactactactcgccc
gccgaattcgtgctcgccgaacatgacagcgactggtgtacgccggtcgacgtgtggggc
agcgacgaggaagtggccgcggtcgaagccgacttcgccaaacagaaggcacgtttcatc
gacaacggcattcccgtgatcatcggcgagtacggtcttctgaccgaacccgtcgaccat
aaggatcacgacagcaacatcaagtggctgcgtaccgtcatccgctgcgcgctgaccaat
ggctcctgcccgatcctatgggacacctccaccaaggaaatgtgcttcctcaaccgcgaa
accggccgtttctttgatcccgaggtcgaagccatctaccaagaggcgcgcaccatgtcg
gtggcacaataa

DBGET integrated database retrieval system