KEGG   Bifidobacterium dentium: BDP_2201Help
Entry
BDP_2201          CDS       T01143                                 

Gene name
malQ1
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bde  Bifidobacterium dentium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bde00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2528134..2530299
Genome map
AA seq 721 aa AA seqDB search
MTASTQHTESAERIARPLIQLAKINGISTSYIDQLGTYVEIRDEVLVSVLAALGVDASTE
QAITDSYAEARQRIADTLIPPTVVKFIGRPTTIPIHNKGNDVTLRLMLEDGTQYAENLCM
HLMPQNDGSLQLNLPDDIPVGYHTLRVNAGEMHGEATLICASTRIELPKAVAEKQRWGWM
TQLYSVRSAESWGVGDYGDLRRLLKDAAEKSHADFMLINPIHATAPIEPLEPSPYLPESR
RFLNVTYIRPQDIEEYANLDEVDLAEVERLHAEVSPANDDPNPMDINTAWWHKRKALQRI
YAVPRSARRQSAFEAFKEASGPDLRAFAAWSVAFEVWGAPWESSWFGETNRDSPEVATLM
HEHADLMDFECWLQWIAAEQVTAAQSTARESGMALGLVQDMAVGVHALGADVWWNPERFA
VGSVTVGCPPDFYNQQGQDWGQPPFNPNYLEKTGYGVYRDMVHNMFSRAGAVRIDHVLGL
FRLWWIPQGEGAKGGAYVTYDYEAMIAILTIEATRANGLVIGEDLGTVPDYVRTVLADHG
LLGCMVEWFARVDDSPNAGDPYADPATYRKYALASVTTHDLPPTAGYLEFEHVKLREQLH
LLSGPVEEFRASAAAERQAMLDRLVESGLVTPDVAADVDGHIQEIVEAMHRMLLSSPSVL
LQAALVDGVGETRSQNQPGTSSEYSNWRVPLAGPDGKVIHTDEVFDLPRVQSLAAIMNGG
K
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgacagcatcaacgcagcacaccgaaagcgccgagcgtatcgcgcgcccgcttatccag
ctggccaaaatcaacggcatctccacctcgtatatcgaccagctcggcacctatgttgag
atccgcgacgaagtgcttgtttccgtgctggccgcactgggtgtggacgcatccaccgag
caagccatcaccgattcatacgccgaggccaggcagcgcattgccgatacgctcataccg
ccgaccgtggtgaagttcatcggcagaccgaccaccatccccattcataacaagggcaac
gatgtgacgttgcgtcttatgctggaagacggtacgcaatacgccgaaaacctgtgcatg
cacctgatgccgcaaaatgacggctcactgcagctgaatctgcctgacgacattcccgtc
ggctaccataccctacgcgtaaacgcaggtgagatgcacggcgaggcgacgctgatctgc
gcatcgacccgcatcgaattgccgaaagccgttgccgaaaagcagcgttggggttggatg
acgcagctgtattccgtacgttccgccgaatcgtggggcgtaggcgattacggcgatctg
cgaagactgctgaaagacgccgcggagaagtcgcacgccgacttcatgctgatcaatccg
atccatgcgaccgcaccgatcgagccacttgagccttcgccgtatctgccggaatcccgt
cgattcctcaacgtcacctatattcggccgcaggatatcgaggagtatgccaatctcgat
gaagtcgacctggccgaggtcgaacgtctgcatgccgaagtgtcgccggccaacgacgac
ccgaatccgatggacatcaataccgcatggtggcataagcgcaaggccctgcaacgcata
tatgcagtaccgcgttccgccaggcgccaatcggcattcgaggcgttcaaggaggcgtca
ggcccggatctgcgcgcattcgccgcatggtcggtggcatttgaggtatggggtgcccca
tgggagagctcttggttcggcgagacgaaccgtgattcacccgaggtggccacgttaatg
cacgaacacgccgacctgatggatttcgaatgctggctgcagtggatcgccgccgaacag
gtgactgccgcgcagagcaccgcacgcgaatccggcatggcgctgggcctggtgcaggat
atggccgtgggcgtgcacgcattgggcgccgacgtgtggtggaatccggaacgttttgcc
gtcggtagcgtgaccgtaggttgcccgcccgacttctacaaccaacagggtcaggattgg
ggccagccgccgttcaatccgaattatctggagaaaaccggttacggcgtatatcgcgac
atggtgcacaacatgttctctcgtgcaggtgcggtacgcatcgaccatgtgctgggcctg
ttccgcctgtggtggattccgcagggcgaaggcgcgaagggcggtgcgtatgttacgtat
gattacgaggcgatgatagcgatccttaccatcgaagccacgcgcgcgaacggtttggtg
attggcgaggacctgggcaccgtaccggactacgtccgcaccgtacttgccgatcatggg
ctgcttggctgcatggtggaatggttcgcgcgcgtggatgactcccccaacgccggtgat
ccttatgccgatcccgccacgtaccgcaagtatgcgttggcatccgtcaccacacacgac
ctgccgccgaccgccggctatctcgaattcgaacacgtgaagctacgcgagcaattgcat
ttgctatcgggtccggtcgaggagttccgggcttccgcggctgcggaacgccaggccatg
ctcgaccgactggtggaaagcggattggtcacgccggacgtcgccgccgatgtggacggg
catatccaggagatcgtagaggcaatgcacaggatgctgctcagctcgccgtccgtgctc
ttgcaggccgcgctggtcgatggcgtgggtgaaacccgttcacagaaccaaccgggcact
tccagcgaatactccaactggcgcgtgccgctggccggccccgatggcaaggtcatccac
accgatgaggtgttcgacctgccacgcgttcaatctcttgccgccatcatgaacggcggc
aagtag

DBGET integrated database retrieval system