KEGG   Bifidobacterium dentium: BDP_2201Help
Entry
BDP_2201          CDS       T01143                                 

Gene name
malQ1
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bde  Bifidobacterium dentium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BDP_2201 (malQ1)
Enzymes [BR:bde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BDP_2201 (malQ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2528134..2530299
Genome map
AA seq 721 aa AA seqDB search
MTASTQHTESAERIARPLIQLAKINGISTSYIDQLGTYVEIRDEVLVSVLAALGVDASTE
QAITDSYAEARQRIADTLIPPTVVKFIGRPTTIPIHNKGNDVTLRLMLEDGTQYAENLCM
HLMPQNDGSLQLNLPDDIPVGYHTLRVNAGEMHGEATLICASTRIELPKAVAEKQRWGWM
TQLYSVRSAESWGVGDYGDLRRLLKDAAEKSHADFMLINPIHATAPIEPLEPSPYLPESR
RFLNVTYIRPQDIEEYANLDEVDLAEVERLHAEVSPANDDPNPMDINTAWWHKRKALQRI
YAVPRSARRQSAFEAFKEASGPDLRAFAAWSVAFEVWGAPWESSWFGETNRDSPEVATLM
HEHADLMDFECWLQWIAAEQVTAAQSTARESGMALGLVQDMAVGVHALGADVWWNPERFA
VGSVTVGCPPDFYNQQGQDWGQPPFNPNYLEKTGYGVYRDMVHNMFSRAGAVRIDHVLGL
FRLWWIPQGEGAKGGAYVTYDYEAMIAILTIEATRANGLVIGEDLGTVPDYVRTVLADHG
LLGCMVEWFARVDDSPNAGDPYADPATYRKYALASVTTHDLPPTAGYLEFEHVKLREQLH
LLSGPVEEFRASAAAERQAMLDRLVESGLVTPDVAADVDGHIQEIVEAMHRMLLSSPSVL
LQAALVDGVGETRSQNQPGTSSEYSNWRVPLAGPDGKVIHTDEVFDLPRVQSLAAIMNGG
K
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgacagcatcaacgcagcacaccgaaagcgccgagcgtatcgcgcgcccgcttatccag
ctggccaaaatcaacggcatctccacctcgtatatcgaccagctcggcacctatgttgag
atccgcgacgaagtgcttgtttccgtgctggccgcactgggtgtggacgcatccaccgag
caagccatcaccgattcatacgccgaggccaggcagcgcattgccgatacgctcataccg
ccgaccgtggtgaagttcatcggcagaccgaccaccatccccattcataacaagggcaac
gatgtgacgttgcgtcttatgctggaagacggtacgcaatacgccgaaaacctgtgcatg
cacctgatgccgcaaaatgacggctcactgcagctgaatctgcctgacgacattcccgtc
ggctaccataccctacgcgtaaacgcaggtgagatgcacggcgaggcgacgctgatctgc
gcatcgacccgcatcgaattgccgaaagccgttgccgaaaagcagcgttggggttggatg
acgcagctgtattccgtacgttccgccgaatcgtggggcgtaggcgattacggcgatctg
cgaagactgctgaaagacgccgcggagaagtcgcacgccgacttcatgctgatcaatccg
atccatgcgaccgcaccgatcgagccacttgagccttcgccgtatctgccggaatcccgt
cgattcctcaacgtcacctatattcggccgcaggatatcgaggagtatgccaatctcgat
gaagtcgacctggccgaggtcgaacgtctgcatgccgaagtgtcgccggccaacgacgac
ccgaatccgatggacatcaataccgcatggtggcataagcgcaaggccctgcaacgcata
tatgcagtaccgcgttccgccaggcgccaatcggcattcgaggcgttcaaggaggcgtca
ggcccggatctgcgcgcattcgccgcatggtcggtggcatttgaggtatggggtgcccca
tgggagagctcttggttcggcgagacgaaccgtgattcacccgaggtggccacgttaatg
cacgaacacgccgacctgatggatttcgaatgctggctgcagtggatcgccgccgaacag
gtgactgccgcgcagagcaccgcacgcgaatccggcatggcgctgggcctggtgcaggat
atggccgtgggcgtgcacgcattgggcgccgacgtgtggtggaatccggaacgttttgcc
gtcggtagcgtgaccgtaggttgcccgcccgacttctacaaccaacagggtcaggattgg
ggccagccgccgttcaatccgaattatctggagaaaaccggttacggcgtatatcgcgac
atggtgcacaacatgttctctcgtgcaggtgcggtacgcatcgaccatgtgctgggcctg
ttccgcctgtggtggattccgcagggcgaaggcgcgaagggcggtgcgtatgttacgtat
gattacgaggcgatgatagcgatccttaccatcgaagccacgcgcgcgaacggtttggtg
attggcgaggacctgggcaccgtaccggactacgtccgcaccgtacttgccgatcatggg
ctgcttggctgcatggtggaatggttcgcgcgcgtggatgactcccccaacgccggtgat
ccttatgccgatcccgccacgtaccgcaagtatgcgttggcatccgtcaccacacacgac
ctgccgccgaccgccggctatctcgaattcgaacacgtgaagctacgcgagcaattgcat
ttgctatcgggtccggtcgaggagttccgggcttccgcggctgcggaacgccaggccatg
ctcgaccgactggtggaaagcggattggtcacgccggacgtcgccgccgatgtggacggg
catatccaggagatcgtagaggcaatgcacaggatgctgctcagctcgccgtccgtgctc
ttgcaggccgcgctggtcgatggcgtgggtgaaacccgttcacagaaccaaccgggcact
tccagcgaatactccaactggcgcgtgccgctggccggccccgatggcaaggtcatccac
accgatgaggtgttcgacctgccacgcgttcaatctcttgccgccatcatgaacggcggc
aagtag

DBGET integrated database retrieval system