KEGG   Bifidobacterium dentium Bd1: BDP_4001Help
Entry
BDP_4001          CDS       T01143                                 

Definition
(GenBank) glycosyl transferase, family 2
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2129071..2130012
Genome map
AA seq 313 aa AA seqDB search
MSSVAIMLATYNGAKYLEEQIESIVSQTFEDWTLYIRDDNSIDATASIIKRYTEKYPDRI
VNIDDKKLRGGSSKANFASIQKWVTIHNPHRYYMFSDQDDYWKPEKIELTLATMQKTEAI
FDGPILVHTDLEVVDENLKTLGDSFFAYRALNPDVTDLPHLLVQNNVTGCTMCWNSKLNE
LLDLADPAVAMHDWWITLVAATLGKIVHVSETTIKYRQHGDNVVGATKVNTLGFILKRLS
GSAHVRQTLKMAHSQAAAFRRKYQEALSQVQIKTLDKFIALPSMHKVSRVSRVIEGRFLK
QGIIQIIGELIYV
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtctagcgttgccataatgttggctacttacaatggtgccaaatatctcgaagaacaa
atcgaatcgattgtttctcaaacattcgaagactggaccctctatattcgagatgacaat
tcaatcgatgctacagcaagcatcattaaacgttatacagaaaagtacccagatagaatc
gtcaatatcgatgataaaaaattaagaggaggtagctcaaaagcaaattttgcttcgatt
caaaaatgggtcaccatacacaatcctcatcgctactatatgttttccgaccaagatgac
tactggaagcccgagaaaatagagcttactctcgcaacaatgcaaaagacggaagcgatt
tttgacggaccaattctagttcatacagatctagaggttgtagatgaaaatctaaagact
cttggcgactctttttttgcctatagagcattgaaccctgatgtcacagatttaccacat
ctcctcgtacaaaataacgttactggatgtacgatgtgttggaattccaagctcaatgag
ttgcttgatcttgctgatcctgcggtcgcgatgcacgattggtggattactcttgtcgca
gctactctaggaaaaatcgtccacgtctcagaaacaacgattaagtatcgtcagcacgga
gacaatgttgtaggcgccaccaaagtcaataccctaggttttattttgaagagactttcc
ggcagtgctcacgtacgacaaaccctgaaaatggcgcattcccaagccgctgcttttaga
agaaaataccaagaagcactctcacaagttcaaattaaaaccttggataaattcatcgct
ttaccttcgatgcataaggtatctcgcgtcagcagggtaattgaaggaagattcctcaaa
cagggaataatccaaataatcggcgagctgatatatgtctag

DBGET integrated database retrieval system