KEGG   Brachypodium distachyon: 100821249Help
Entry
100821249         CDS       T01717                                 

Definition
calcineurin B-like protein 1-like
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
bdi  Brachypodium distachyon
Brite
Protein phosphatases and associated proteins [BR:bdi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100821249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 212 aa AA seqDB search
MGCFHSKPRRQYPGYEDPISLASQTTFSVSEVEALFELFKSISGSVIDDGLINKEEFQLA
LFKSKKDNLFANRIFDLFDVKKRGVIDFADFVRALNVFHPSIPMEEKIDFSFKLYDMDNT
GFIERNEVKQMLVALLSESEMRLSDETIETILDKTFSDADVNQDGKIDRAEWENFVSRNP
SLLKIMTLPYLKDITTTFPSFVFHSEVDDIVT
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcttccattccaagcccaggcgacagtacccaggctacgaggatcccatcagt
ctcgcgtcacagactacattcagcgtcagcgaagtcgaagcgctatttgagctgttcaag
agtattagtggttctgttattgatgatggtctcatcaacaaggaagagttccagcttgca
ttgtttaagagcaagaaggacaatctttttgctaatcggatatttgaccttttcgatgtc
aagaaaaggggggtcattgactttgctgactttgttcgagctctaaatgtatttcaccct
agcattccgatggaagagaaaattgatttttccttcaagctatatgatatggacaacaca
ggcttcattgaacgaaatgaggtcaagcagatgcttgttgctcttctgagtgaatcggaa
atgaggttatcagatgaaaccattgagacaatcctggacaagacattttcagacgctgat
gtgaatcaggatggaaaaatagatagagcagagtgggagaactttgtctcacggaatcct
tccttgctgaagataatgactcttccataccttaaagacataacgactacattccctagc
tttgtttttcattcggaggttgatgatatcgtgacatga

DBGET integrated database retrieval system