KEGG   Brachypodium distachyon: 100821269Help
Entry
100821269         CDS       T01717                                 

Definition
arginase-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bdi  Brachypodium distachyon
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bdi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bdi00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 342 aa AA seqDB search
MGAAAAAAAAGAAKWIQRLGAAGISTEALERGQSRVIDASLTLIRERARLKGELLRSMGD
VKASASLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSSTEEGKELDDPRVLTDVGDV
PIQEIRDCGVGDDRLMHVISESVKTVMEEDPLRPLVLGGDHSISYPVVRAVSEMLGGPVD
ILHLDAHPDIYDCFEDNPYSHASSFARIMEGGHARRLLQVGLRSITKEGREQGKRFGVEQ
YEMRTFSRDREKLENLKLGEGVKGVYISVDVDCLDPAFAPGVSHIEPGGLSFRDVLNILQ
NLQGDVVAADVVEFNPQRDTVDGMTAMVAAKLVRELTAKISK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggcggcggcggcggcggcggcgggcgctgccaagtggatccagcggctgggc
gcggccgggatctcgacggaggcactggagcgcgggcagagccgcgtcatcgacgcctcc
ctcaccctcatccgcgagcgcgccaggctcaagggagagttgctgcgttctatgggtgat
gtgaaagcttccgcgtccctcttaggagtaccccttgggcacaactcctcgttcctgcag
ggtcctgcatttgctccgccccgcataagggaagcgatttggtgcggaagcaccaactct
agcacggaagaaggcaaagaattagatgatccaagagtgctaactgatgttggtgatgtc
cccatacaagagattcgtgactgtggtgttggagatgacagattgatgcatgtaatcagc
gagtctgtcaaaacagtgatggaggaagatcctcttcggccattggtattaggaggcgat
cactcaatatcttatccagttgttagggccgtgtctgaaatgcttggtggacctgttgac
attcttcatcttgacgcacatccagatatctatgattgttttgaagacaacccttactca
catgcttcttcatttgcaagaataatggaaggaggtcatgctaggagacttctgcaggtt
ggacttagatcaattaccaaagagggacgcgaacaaggaaaaagatttggtgtagaacag
tatgagatgcgtaccttctccagagatcgggagaagcttgagaatctgaaacttggggaa
ggtgtaaagggagtgtatatctctgtcgatgtggactgcctcgacccagcattcgctcct
ggcgtctctcacattgaacctggaggcctctcgttccgcgatgtgctcaacatcctccag
aatctgcaaggtgatgtcgttgccgcagatgtggtggagttcaacccacaacgtgacacg
gtggatggtatgacagccatggtcgccgcaaagctggttcgggagctcactgccaagatc
tccaagtga

DBGET integrated database retrieval system