KEGG   Brachypodium distachyon: 100821528Help
Entry
100821528         CDS       T01717                                 

Definition
(RefSeq) replication protein A 32 kDa subunit B-like
  KO
K10739  replication factor A2
Organism
bdi  Brachypodium distachyon
Pathway
bdi03030  DNA replication
bdi03420  Nucleotide excision repair
bdi03430  Mismatch repair
bdi03440  Homologous recombination
Module
bdi_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100821528
   03420 Nucleotide excision repair
    100821528
   03430 Mismatch repair
    100821528
   03440 Homologous recombination
    100821528
DNA replication proteins [BR:bdi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100821528
DNA repair and recombination proteins [BR:bdi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100821528
   MMR (mismatch exicision repair)
     100821528
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100821528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon RMI2 CDC24_OB3
Motif
Other DBs
NCBI-GeneID: 100821528
NCBI-ProteinID: XP_003575423
UniProt: I1IBU9
Position
3
AA seq 297 aa AA seqDB search
MYGGGGGGGGQYSGGGGGQYGGGGGGGHYEGGGADNSSTLFSGGGFMPSQATNTPEGSSS
FPRTRNAQTLLPVTVKQLMDACQINDDRSSFAVNGTELSTVRLVGRMLNKTERVTDVSFI
LDDCTGRIDVNRWENETSDTNEMNEVKNGDYVIVNGCLKGFQGKRHVNAYSVRLVTNYND
ITHHFLYCIYVHLDLSKSKRQLNAKTGTLNQAPVPNNQAPTSSASGNSTGTELSKLVMSV
FHDPVLINVEHGVSVQQVADRLKLSEELARSTVQELVDLGNLYSTIDDNHYKSTLNG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcggcggcggcggtggcggcggacaatacagcggcggcggaggcggacaatac
ggcggcggtggcggaggtgggcactacgagggcggcggcgccgataactccagtaccctc
ttcagcggcggcggcttcatgccctcgcaggccaccaacaccccggagggcagcagcagc
ttccccaggactcgcaacgcgcagacgctgctcccggtcaccgtgaagcagctcatggac
gcctgccagataaatgatgacaggtccagtttcgctgtcaatggaacagagttgtccacg
gttaggcttgtaggacgcatgttgaataagactgagagagtgacagatgtatcgttcatt
cttgatgactgtacaggccggatagatgttaatcgctgggaaaatgagacgtctgacacg
aatgaaatgaatgaagtaaagaacggtgactatgtaattgttaatggttgtctgaaaggc
tttcaagggaagcgccacgtgaatgcttattctgtgcggcttgtaaccaactataatgat
ataacacatcactttctgtactgcatttatgtgcatttggatctctccaagtctaagcgc
cagttaaatgctaaaacaggaacattgaaccaagctcccgtccctaataatcaggcgcca
acgtcctctgcatccggaaattcgactgggacagagttatccaaattggtcatgagtgta
tttcatgatcccgtgcttataaacgtggagcatggagtaagtgtgcaacaggtcgcagat
cgtcttaaactatcagaggaactggccaggtcgactgttcaagaacttgttgatcttggc
aacctctattcgactatcgatgacaatcattacaagtctacactgaatggttga

DBGET integrated database retrieval system