KEGG   Brachypodium distachyon: 100821631Help
Entry
100821631         CDS       T01717                                 

Definition
serine/threonine-protein phosphatase PP1-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
bdi  Brachypodium distachyon
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100821631
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100821631
Protein phosphatases and associated proteins [BR:bdi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100821631
Transcription machinery [BR:bdi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100821631
Spliceosome [BR:bdi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100821631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 305 aa AA seqDB search
MDGNALEELIRRLLDGKKNKGPGKKVQISEAEIRHLCVTAKEIFLSQPNLLELEAPINVC
GDIHGQFSDLLRLFDYGGLPPSANYLFLGDYVDRGKQSIETICLLLAYKIKFPDNFFLLR
GNHECASINRIYGFYDECKRRFSVRLWKLFTDCFNCLPVAAVIDDKILCMHGGLSPDLDS
LDRIREIQRPVDVPDQGLLCDLLWSDPDRESSGWGENDRGVSFTFGADKVAEFLNKHDLD
LICRAHQVVEDGYEFFADRQLVTIFSAPNYCGEFNNAGALMNVDASLLCSFQILKPLRGR
SQTEG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggacgggaacgccctcgaggagctgatacggcggctcctggacgggaagaagaacaag
gggccggggaagaaggtgcagatcagcgaggcggagatccggcacctctgcgtcaccgcc
aaggagatcttcctctcccagcccaacctcctcgagctcgaggcccccatcaacgtctgc
ggcgacatccacgggcaattctcggacctgctgcggctgttcgactacggcgggctgccg
ccgagcgccaactacctgttcctgggcgactacgtggaccggggcaagcagagcatcgag
accatctgcctgctgctggcctacaagatcaagttcccggacaacttcttcctgctgaga
gggaaccacgagtgcgcctccatcaaccgaatctacggcttctacgacgagtgcaagcgc
cgcttcagcgtgcgcctctggaagctcttcaccgactgcttcaactgcctccccgtcgcc
gccgtcatcgacgacaagatcctctgcatgcacggcggcctctccccggacctcgacagc
ctcgaccggatcagggagatccagcggcccgtcgacgtccccgaccagggcctcctctgc
gacctcctctggtccgaccccgaccgcgagagctccggatggggcgagaacgaccgcggc
gtctccttcaccttcggcgccgacaaggtcgccgagttcttgaacaagcacgacctcgac
ctcatctgccgcgctcaccaggttgtggaggacgggtacgagttcttcgcggaccggcag
ctggtgacaatattctccgcgcccaactactgcggggagttcaacaacgccggcgcgctc
atgaacgtcgacgccagcctgctctgctccttccagatcctcaaaccgttgagaggcaga
tcgcagacggagggatga

DBGET integrated database retrieval system