KEGG   Brachypodium distachyon: 100822064Help
Entry
100822064         CDS       T01717                                 

Gene name
CBL2
Definition
calcineurin B-like protein 2-like
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 225 aa AA seqDB search
MVQCLDGVKQLCAALFKCFDLELKQPRGLQDPQALARETVFSVSEIEALYELFKKISSAV
IDDGLINKEEFQLALFKTSKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNASAD
EKIDFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLSDEIIESIIDKTFEEADTKHDG
KIDKEEWHNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagtgtctcgacggcgtgaagcagctctgcgcggcgctgttcaagtgtttcgac
ctcgagctcaagcagccccgggggctccaggatccccaggccctcgcgagggagaccgtc
tttagcgtcagcgagatcgaggcgctgtacgagctgttcaagaagattagcagcgctgtg
atcgatgacgggttgattaacaaggaggagtttcagttggcgctcttcaagacgagcaag
aaggagagcctgtttgctgatcgtgtttttgatttgtttgatacaaagcacaatggaatt
ttaggatttgaagaatttgctcgtgcactctcggtgtttcatccaaatgcttccgctgat
gagaaaattgacttttcattccagctatatgatctcaagcaacaaggcttcattgagaga
caggaggttaagcagatggttgttgctacacttgcggagtcagggatgaatctttctgat
gaaattatagaaagcataattgataagacgtttgaggaggcagacacaaagcatgatgga
aaaattgacaaagaagagtggcacaatctggttcttcggcatccatctttgctgaaaaac
atgactctccagtacctcaaggacatcaccactacatttccaagctttgtcttccattcg
caggttgatgatacctga

DBGET integrated database retrieval system