KEGG   Brachypodium distachyon: 100822093Help
Entry
100822093         CDS       T01717                                 

Definition
eukaryotic translation initiation factor 3 subunit B-like
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
bdi  Brachypodium distachyon
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100822093
Messenger RNA biogenesis [BR:bdi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100822093
Translation factors [BR:bdi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100822093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 718 aa AA seqDB search
MALAISMEAIDARARELGIDIDSVDVDSITLPPGEDFDILSDDEDLLHNEDLPELEMGFA
NIIVVDNLPVVPPEKYEKLENVVRKIYSQIGVIKEGGLWMPTDPETKKTLGYCFIEYNTP
QEAELAREKTNGYKLDKSHIFAVNMFDDFDKYMKVPDEWAPAEIKPYTPGENLLKWLTDE
KARDQFVIRAGTFTEVYWNDARRAMPELVYQKQYWTDSYIQWSPLGTHLATVHRQGAQVW
GGDDKFVRLMRFAHPQVKLIDFSPGEKYLVTYSSHEPSNPRDTHRVVLNIFDVRTGKVMR
DFKGSADEFTTGGSIGVSGVSWPIFRWGGGRDDKYFARLGKNVISVYETETFSLLDKKSL
KVENVVDFSWSPTDPIISLFVPELGGGNQPARVSLVQIPGKEEVRQKNLFSVSDCKMYWQ
NNGEYLAVQVDRYTKTKKSIYTGFELFRIKERDIPIEVFELDNKNDKIIAFAWEPRGHRF
AVIHGDGPKPDISFYTMRTVNNVSRVSKLTTLKGKQANALFWSPAGRFIVLAGLKGFNGQ
LEFYNVDDLETMATGEHFMATDIMWDPTGRFLATAVTSVHEMENGFQIWSFNGKQIYKVS
KDHFYQFHWRPRPPSLLTPEKEEDISRNLKKYSKKYEQEDQDVFNQVGEQERKRRTQLQE
EWEGWVAKWKQQHEEEREYRMALRGGEDSEKEEEGEIKEIEAEELLNVTEEVVSFDQD
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggctctagcaatctctatggaagccatcgatgcgagggcgcgggagctggggatcgac
atcgactccgtcgatgtcgactccatcacccttccacccggcgaggacttcgatatcctc
agtgatgacgaggatttacttcacaatgaggatcttccagagcttgaaatgggttttgca
aacattattgtagtggataatctgcctgttgtacccccagagaagtatgagaagctggaa
aatgttgtacgcaagatctatagtcaaattggtgtgatcaaagaaggtgggctttggatg
cctacggacccagagacaaagaagacccttggctactgcttcattgagtataatacccca
caggaagctgaacttgctagagagaaaacaaatgggtacaaactggacaagtctcatata
tttgctgttaatatgtttgatgacttcgataagtacatgaaagtccctgatgaatgggcg
cctgctgaaatcaagccatacactccgggggaaaatctacttaagtggctaactgatgag
aaggccagagatcagtttgtgatccgcgctggtactttcacagaagtgtactggaacgat
gctagacgggcaatgcctgagcttgtgtaccagaaacagtattggacggatagctatatt
caatggtcccctcttggaacacacctggcaacagtgcataggcagggcgctcaggtgtgg
ggcggtgatgataagtttgttcgtctaatgcgctttgctcatccacaggtgaaactgatt
gatttctctcctggtgagaaatatttggtcacatatagcagccatgagcccagcaaccct
agggacacacatagggttgtgctaaatatctttgatgtaaggactggaaaagttatgcgt
gactttaagggaagtgctgatgaattcactactggtggaagtattggtgtttctggtgtt
tcgtggcctattttcaggtggggcggtggaagagatgataagtattttgctagactgggg
aagaatgtcatatctgtctatgagactgagacgttctctcttcttgacaagaagtccttg
aaggtagaaaatgttgtggacttcagttggtcacccactgatcctatcatatccctgttt
gtgcctgaattgggtggtggaaatcagcctgccagggtaagtcttgtgcaaattcctggc
aaagaggaggtgcgacaaaaaaaccttttcagtgtaagcgattgcaaaatgtactggcaa
aacaatggagaatatcttgctgtccaagtagataggtacacaaaaacaaagaagagcatt
tacactgggtttgagctgttcagaatcaaggaacgggatatcccaattgaggtatttgag
ttggacaacaagaatgacaagataattgcctttgcatgggagcccagaggtcaccgcttt
gctgtcattcacggtgatgggcccaagcctgatataagtttctacaccatgcgcacagtc
aacaatgtgagccgtgtgtccaaactcaccacacttaagggcaagcaggctaatgcacta
ttctggtctcctgctgggcgtttcattgttcttgctgggctgaagggtttcaatggccag
ttggagttctacaatgttgatgatcttgagaccatggcaacaggagagcattttatggcg
actgacatcatgtgggatcccactggaagatttcttgcaactgcagttacctcggtccat
gagatggaaaatggttttcaaatttggtccttcaatggcaagcaaatttacaaggtgtca
aaggatcacttttatcagttccattggcgcccaaggccaccgtcactacttacaccagag
aaggaggaggatatctcacgaaacctcaagaagtacagcaagaagtacgaacaagaggac
caggacgttttcaaccaggtgggtgagcaggagcggaagagacggacacagcttcaagag
gaatgggaaggatgggttgctaagtggaagcagcagcatgaggaggagcgagagtacagg
atggcgcttagaggtggggaggacagtgagaaggaagaagaaggtgaaatcaaggagatt
gaggcggaggagttgttgaatgtcacagaagaagtcgtttccttcgaccaggattaa

DBGET integrated database retrieval system