KEGG   Brachypodium distachyon: 100822417Help
Entry
100822417         CDS       T01717                                 

Definition
serine/threonine-protein phosphatase PP1-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
bdi  Brachypodium distachyon
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:bdi03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 325 aa AA seqDB search
MAAMDAETLDDVIRRLLEARGGRTARPAQLSDAEIRRLCAAAREVFLGQPNLLELEAPIK
VCGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSIETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFFDECKRRFNVRLWKVFTDCFNCLPVAALIDDKILCMHGGLSPEL
KNMDQIRNIARPVDVPDHGLLCDLLWSDPDKEIDGWGENDRGVSYTFGADKVAEFLEKHD
LDLVCRAHQVVEDGYEFFAKRQLVTIFSAPNYCGEFDNAGAMMSIDDSLTCSFQILKPSD
KKGKAGAGNMSKPGTPPRKIKINII
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgatggacgcggagacgctcgacgacgtgatccggcggctcctggaggcgcgc
ggcggccgcacggcgcgccccgcgcagctctccgacgcggagatccgccggctctgcgcc
gccgccagggaggtcttcctcggccagcccaacctcctcgagctcgaggcccccatcaaa
gtctgcggggacatccatggacaatatactgatcttcttcgattatttgagtatggtggc
ttcccaccggaggcaaattatctgtttctgggagactatgttgatcgtggcaaacagagt
attgaaacaatatgccttctacttgcttacaagataaagtacccggagaacttctttctc
cttaggggaaaccatgaatgtgcgtcgatcaatcgaatttatggattctttgatgaatgc
aagaggaggtttaacgttcgtctctggaaggtttttactgattgttttaactgtctccct
gtggctgctcttattgatgataagatcctgtgcatgcatgggggtttatcacctgagtta
aagaatatggaccagatacgcaacattgcccgtcctgtggatgttccggaccatggtctc
ctctgtgatctgctgtggtcagacccagacaaggaaattgatggctggggtgagaatgac
aggggtgtgtcttacacattcggagctgataaggttgcggagttccttgagaaacatgat
ctcgatttggtctgcagagcccaccaggtggtggaggatgggtatgaattctttgctaag
cgccagcttgtaaccatattctcggcacccaactactgtggcgagtttgacaatgctggt
gctatgatgagcatagacgattccttaacatgctcattccaaattcttaagccttctgat
aagaaaggaaaagctggagctggcaacatgtcaaaacctggaacgcctcctaggaagata
aagattaatattatttag

DBGET integrated database retrieval system