KEGG   Brachypodium distachyon: 100822570Help
Entry
100822570         CDS       T01717                                 

Definition
protein-L-isoaspartate O-methyltransferase-like
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100822570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 231 aa AA seqDB search
MENRLWSSGASDKNKAMVEQLQRYGVIKSTKVAEVMETIDRGLFVPPGGSPYFDSPMSIG
YNATISAPHMHAACLELLEDHLQPGMRVLDVGSGTGYLTACFALMVGPEGRAVGVEHIPE
LVASSTENIKKSAAAPQLDDGSLSIHIADGREGWPELAPYDSIHVGAAAPQIPEALIEQL
KPGGRMVIPVGTVFQELKVVDKKPDGSVSVRDETSVRYVPLTSKDAQLHSD
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccgactatggtcgagcggagctagcgacaagaacaaggccatggttgagcaa
ctgcagaggtatggggtaatcaagtcgaccaaagtcgcggaggtgatggagaccatcgac
aggggcctgtttgtgcctcccggtggctctccctattttgacagcccaatgtcgattggg
tacaatgcaaccatatccgcacctcacatgcatgctgcttgtttggagctcttagaggat
catcttcagcctggaatgcgggttctggatgttggatcaggtaccggttacctaacagct
tgctttgcgctcatggttggaccagaaggacgagcagttggtgttgaacatattccagag
ttggttgcttcttctactgaaaacatcaagaaaagtgcagcagctccacagctggatgat
ggatccctcagtattcatattgctgatggcagggaaggctggccagagctcgcgccctac
gactccatccacgtcggagctgcagcgccgcagatcccggaggcgttgatcgagcagctg
aagcctggtggcagaatggtgatccctgtcgggactgtcttccaggagctgaaggtggtg
gacaagaagccagacggctcagtcagtgtgagagacgagacgtccgtgcgctatgtgccc
ctcaccagcaaggatgcccagctgcactcagactga

DBGET integrated database retrieval system