KEGG   Brachypodium distachyon: 100822745Help
Entry
100822745         CDS       T01717                                 

Definition
profilin-2/4-like
Orthology
K05759  
profilin
Organism
bdi  Brachypodium distachyon
Brite
Exosome [BR:bdi04147]
 Exosomal proteins
  Proteins found in most exosomes
   100822745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 131 aa AA seqDB search
MSWQTYVDEHLMCEIEGHHLGSAAILGHDGTVWAQSAAFPAFEPKEMTDIMKDFDEPGHL
APTGMFLGGAKYMVIAGEPGAVIRGKKGSGGITIKKTGQALVIGIYDEPMTPGQCNMVVE
RLGDYLVEQGM
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcagacgtacgttgacgagcacctgatgtgcgagatcgagggccaccacctc
ggctccgccgccatcctcggccacgacggcaccgtctgggcccagagcgccgccttcccc
gcgttcgagcccaaagagatgaccgacatcatgaaggatttcgacgagccggggcaccta
gccccgaccggcatgttcctcggaggcgccaagtacatggtcatcgccggtgaacctggc
gcggtcatccgcggcaagaagggatcaggaggcatcaccatcaagaagacagggcaggcg
ctggtcatcggcatctacgacgagcccatgacccctgggcagtgcaacatggtggtggag
aggcttggcgactacctcgttgaacaaggcatgtag

DBGET integrated database retrieval system