KEGG   Brachypodium distachyon: 100822804Help
Entry
100822804         CDS       T01717                                 

Definition
(R)-mandelonitrile lyase-like
Orthology
K08248  
mandelonitrile lyase [EC:4.1.2.10]
Organism
bdi  Brachypodium distachyon
Pathway
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of other amino acids; Cyanoamino acid metabolism [PATH:bdi00460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 585 aa AA seqDB search
MAAAPARLRFFLLLVALLPSLAAAQSRPFGGAPPGYARYVADAAGEEQEEYDYIVVGGGA
AGCPLAATLAGPGGGRVLLLERGGAPSEFPALATAGGFVRTLALADPSPESDAPAQAFSS
EDGVANVRARVLGGGTAINAGFYSRAHPSWFQGQGEGAEVTDWDMRLVNASYEWVEQELA
FQPEVHGWQAAVRAALLEANVTPWNGFTVEHVTGTKIGATTFDASGRRHSAADLLAFARP
GRLHVAIRATVTRIIINPIDPAARRGRSRPAVAAVGVVYQDRLLQQHHALLRPGGEVILS
AGALGSPQLLLLSGIGPASDLTSLGIPNSADAPDVGKHMFDNPRNGISIIPSVPIDHSLI
QVVGIPSANGTASYLEAASYIVPLAPMLRPAGPFISPSSPLYVTMATIMEKVPGPLSEGS
LWLSSPNPLETPAVRFNYFSRPEDLAQCVVGVRRVAQVLRSRTMDIFRSTVGSSSQGRRG
PVRRDFRIVGATLPVDWSTNNTAVADFCRRTVTTLWHYHGGCVVGKVVDRDFRVIGTRAL
RVVDGSTFSVTPGTNPQATVMMMGRYVGQKMVGERHSRRQANISS
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgctccagcacgcctcagattcttcctcctcctggtggcactgctcccctcc
ctcgccgcggcccagtcccgccccttcggaggggcgccgccggggtacgcgcggtacgtg
gcggacgcggcgggggaggagcaggaggagtacgactacatcgtggtcgggggcggcgcg
gcggggtgcccgctcgcggccacgctggcggggccggggggcgggcgcgtgctcctgctc
gagcgcggcggcgcgcccagcgagttcccggcgctcgccaccgcgggagggttcgtcagg
acgctcgcgctcgcggacccttcgcccgagtccgacgcgcccgcgcaggcgttcagctcc
gaggacggcgtcgccaacgtgcgcgcacgggtgctcggcggcggcaccgccatcaatgcc
gggttctactcccgcgcgcacccgagctggtttcagggccaaggggagggtgctgaggta
acggattgggacatgcgtctggtgaatgcatcatatgagtgggtggagcaagagctggca
ttccagccggaggtgcatgggtggcaggcggcggtacgcgctgcactgctggaagctaat
gtgacgccgtggaacggcttcacggtggagcatgtcactggcactaagattggtgccacc
acctttgatgcatcagggcgccgccacagcgctgcggacctccttgcttttgcccgtcct
ggtcgtctccatgttgctatccgtgctacggttacccgcatcatcattaaccctattgat
cctgccgcgcgccgtggaaggtctagaccagcagtagcagcagttggcgttgtgtaccag
gaccgtcttctccagcagcaccatgccctgttgcgcccaggtggggaggtcatactttct
gcaggtgccctaggaagtccccaactgctgcttctcagtggcattggtcctgctagtgat
cttacgtccctcggcatccccaattctgctgatgcccctgatgttggcaagcatatgttt
gacaaccctcgtaacggcatctccatcatcccatcagtccctattgaccactcccttatc
caggtagttggcatcccttctgctaatggaactgcctcctacctcgaggctgcgtcatac
attgtcccccttgctcctatgctgcgccctgccggtccttttatcagcccttcttcccca
ctctatgttactatggcaactatcatggaaaaggttcctggcccattatctgagggttca
ctctggctatcatcacccaaccccttggagacccctgccgtccgtttcaactacttcagc
cgccccgaggacctggcacaatgcgtcgtgggggtccgccgtgtcgcgcaagtgctccgg
agcaggacaatggacatattccgttcgacagtagggtcatcgagccaaggcaggagaggg
cctgtcaggagggacttcaggatcgtgggggcaacgctgccagtcgactggagcacgaac
aacacggccgtcgcagatttctgcaggcgaaccgtgacgacgctatggcactatcatgga
gggtgtgtggttgggaaggttgttgacagggatttccgggtcatcggcacgcgcgctctt
cgtgtggtggatgggtcgacattcagcgtgacacctgggacgaatcctcaagccacagtc
atgatgatgggcaggtatgtggggcagaagatggttggggagcgacacagcagaaggcaa
gcgaacatatcatcgtaa

DBGET integrated database retrieval system