KEGG   Brachypodium distachyon: 100822804Help
Entry
100822804         CDS       T01717                                 

Definition
(RefSeq) (R)-mandelonitrile lyase-like isoform X2
  KO
K08248  (R)-mandelonitrile lyase [EC:4.1.2.10]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00460  Cyanoamino acid metabolism
bdi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    100822804
Enzymes [BR:bdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.10  (R)-mandelonitrile lyase
     100822804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C FAD_binding_2 DAO Pyr_redox_2 NAD_binding_8 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 100822804
NCBI-ProteinID: XP_003560382
UniProt: A0A0Q3NHJ2
Position
1
AA seq 585 aa AA seqDB search
MAAAPARLRFFLLLVALLPSLAAAQSRPFGGAPPGYARYVADAAGEEQEEYDYIVVGGGA
AGCPLAATLAGPGGGRVLLLERGGAPSEFPALATAGGFVRTLALADPSPESDAPAQAFSS
EDGVANVRARVLGGGTAINAGFYSRAHPSWFQGQGEGAEVTDWDMRLVNASYEWVEQELA
FQPEVHGWQAAVRAALLEANVTPWNGFTVEHVTGTKIGATTFDASGRRHSAADLLAFARP
GRLHVAIRATVTRIIINPIDPAARRGRSRPAVAAVGVVYQDRLLQQHHALLRPGGEVILS
AGALGSPQLLLLSGIGPASDLTSLGIPNSADAPDVGKHMFDNPRNGISIIPSVPIDHSLI
QVVGIPSANGTASYLEAASYIVPLAPMLRPAGPFISPSSPLYVTMATIMEKVPGPLSEGS
LWLSSPNPLETPAVRFNYFSRPEDLAQCVVGVRRVAQVLRSRTMDIFRSTVGSSSQGRRG
PVRRDFRIVGATLPVDWSTNNTAVADFCRRTVTTLWHYHGGCVVGKVVDRDFRVIGTRAL
RVVDGSTFSVTPGTNPQATVMMMGRYVGQKMVGERHSRRQANISS
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgctccagcacgcctcagattcttcctcctcctggtggcactgctcccctcc
ctcgccgcggcccagtcccgccccttcggaggggcgccgccggggtacgcgcggtacgtg
gcggacgcggcgggggaggagcaggaggagtacgactacatcgtggtcgggggcggcgcg
gcggggtgcccgctcgcggccacgctggcggggccggggggcgggcgcgtgctcctgctc
gagcgcggcggcgcgcccagcgagttcccggcgctcgccaccgcgggagggttcgtcagg
acgctcgcgctcgcggacccttcgcccgagtccgacgcgcccgcgcaggcgttcagctcc
gaggacggcgtcgccaacgtgcgcgcacgggtgctcggcggcggcaccgccatcaatgcc
gggttctactcccgcgcgcacccgagctggtttcagggccaaggggagggtgctgaggta
acggattgggacatgcgtctggtgaatgcatcatatgagtgggtggagcaagagctggca
ttccagccggaggtgcatgggtggcaggcggcggtacgcgctgcactgctggaagctaat
gtgacgccgtggaacggcttcacggtggagcatgtcactggcactaagattggtgccacc
acctttgatgcatcagggcgccgccacagcgctgcggacctccttgcttttgcccgtcct
ggtcgtctccatgttgctatccgtgctacggttacccgcatcatcattaaccctattgat
cctgccgcgcgccgtggaaggtctagaccagcagtagcagcagttggcgttgtgtaccag
gaccgtcttctccagcagcaccatgccctgttgcgcccaggtggggaggtcatactttct
gcaggtgccctaggaagtccccaactgctgcttctcagtggcattggtcctgctagtgat
cttacgtccctcggcatccccaattctgctgatgcccctgatgttggcaagcatatgttt
gacaaccctcgtaacggcatctccatcatcccatcagtccctattgaccactcccttatc
caggtagttggcatcccttctgctaatggaactgcctcctacctcgaggctgcgtcatac
attgtcccccttgctcctatgctgcgccctgccggtccttttatcagcccttcttcccca
ctctatgttactatggcaactatcatggaaaaggttcctggcccattatctgagggttca
ctctggctatcatcacccaaccccttggagacccctgccgtccgtttcaactacttcagc
cgccccgaggacctggcacaatgcgtcgtgggggtccgccgtgtcgcgcaagtgctccgg
agcaggacaatggacatattccgttcgacagtagggtcatcgagccaaggcaggagaggg
cctgtcaggagggacttcaggatcgtgggggcaacgctgccagtcgactggagcacgaac
aacacggccgtcgcagatttctgcaggcgaaccgtgacgacgctatggcactatcatgga
gggtgtgtggttgggaaggttgttgacagggatttccgggtcatcggcacgcgcgctctt
cgtgtggtggatgggtcgacattcagcgtgacacctgggacgaatcctcaagccacagtc
atgatgatgggcaggtatgtggggcagaagatggttggggagcgacacagcagaaggcaa
gcgaacatatcatcgtaa

DBGET integrated database retrieval system