KEGG   Brachypodium distachyon: 100822823Help
Entry
100822823         CDS       T01717                                 

Definition
Pyruvate dehydrogenase [lipoamide] kinase-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100822823
Protein kinases [BR:bdi01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100822823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 364 aa AA seqDB search
MMASEPAARAVAEEVGRWGSMKQTGVSLRYMMEFGSVPTERNLLLSAQFLRKELPIRIAR
RALELDSLPFGLSAKPAILKVRDWYLDSFRDIRYFPEVRNHEDEVAFTKMIKMIKVRHNN
VVPTMALGVQQLKNEQFSSKKLPPGFDEIHGFLDRFYMSRIGIRMLIGQHVALHDPEPEP
GVIGLINTKLSPIQVAQIASEDARSICMREYGSAPDINIYGDPNFAFPYVASHLHLMLFE
LVKNSLRAVQERYMNSDKDVPPVRIIVADGTEDVTIKVSDEGGGIRRSGLPRIFTYLYST
ARNPPDIEGPSEGVTMAGYGFGLPVSRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDSE
EPLP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgtcggagccggccgcgcgggcggtggcggaggaggtggggcggtgggggagc
atgaagcagacgggggtgagcctgcggtacatgatggagttcgggtccgtccccacggag
cgcaacctgctgctctccgcgcagttcctccgcaaggagctccccatccgcatcgcccgc
cgcgccctcgagctcgactccctccccttcggcctctccgccaagcccgccatcctcaag
gtgagagactggtacttggactccttccgcgacatccggtattttccagaagtgaggaat
cacgaagacgaggttgctttcacgaaaatgattaagatgatcaaagtgcggcacaataat
gtggttccgacaatggctttgggagtgcaacaactgaaaaacgaacagtttagctcaaag
aagcttcccccaggatttgacgagatccacgggttccttgatcgattttacatgtcgagg
attggtattcgcatgctgatagggcagcatgtggctttgcatgatcctgaaccagagcct
ggcgtcataggcctcattaatacaaagttgtcccccatacaggtagctcaaattgccagc
gaggatgcacgttccatttgtatgagagaatacggatcagctcctgacatcaacatttat
ggagatccaaattttgcatttccatacgttgcatcacatcttcatctcatgctgtttgaa
ctggtgaaaaattcccttcgtgcagtgcaggaaagatatatgaattctgataaagatgtt
cctcctgtcagaattatagttgctgatggaacagaggatgttactattaaggttagtgat
gaaggtggtggaatacgaagaagtgggctccctagaattttcacgtatctctacagcact
gcaaggaatccacctgatatagagggccctagtgaaggggtaactatggctggatatggt
tttggacttccagttagtcgcctttatgctcggtattttggtggcgatctacaaatcata
tccatggaaggatacggcactgatgcttacctgcacttgtcacggttgggagactcagag
gagccattgccttag

DBGET integrated database retrieval system