KEGG   Brachypodium distachyon: 100822970Help
Entry
100822970         CDS       T01717                                 

Definition
putative glucose-6-phosphate 1-epimerase-like
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
bdi  Brachypodium distachyon
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100822970
Enzymes [BR:bdi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     100822970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 327 aa AA seqDB search
MAAAAAPQSPQQQQQQQPSPLVERVKTAAGLEKLVLRGQRNCSVEISLYGGQVTSWKNDY
GEELLFVSSKANFKPPKPIRGGIPICFPQFGTHGNLEQHGFARNRLWTVDDNPPPLPINP
AIKAFVDLILKPSEDDLKVWPHSFEFRLRIALGQGGDLSLTSRIRNTNTDGRPFSYTFAY
HTHFSVSDISEVRVEGLETMDYLDNIKGKERFTEQGDAIVFESEVDKVYLAAPSKVAIID
HEKKRTFVVTKEGLPDAVVWNPWDKKAKAMQDFGDAEYKHMLCVEPAAVEKPITLKPGEE
WKGRLALSAVPSSYCSGQLDPQRVLHG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcggccgctccgcagtcgccgcagcagcagcagcagcaacagccgtcgccg
ctcgtggagcgtgtcaagaccgccgccggcctcgaaaagttggtgctacgcggacagcgc
aactgctccgtcgagatctctctttacggaggccaagtaacttcgtggaagaatgactat
ggggaggagttgctttttgttagcagcaaggccaatttcaaacctccaaaacctattcgt
ggtggaatacccatttgttttccgcaatttggaactcatggaaatcttgaacaacatgga
tttgcaaggaaccggctttggacagttgatgacaatccaccccctttaccaataaaccct
gctattaaagctttcgttgatcttattctgaagccttctgaagatgatttaaaggtgtgg
ccacacagttttgagttccgcttgagaatcgctcttggtcagggtggagatttgagtctg
acatctcgaatcaggaacaccaatactgatggaagacctttctcttatacatttgcatat
cacacgcacttctctgtgtccgacataagtgaagtgcgtgttgaagggctggaaacaatg
gactaccttgacaatataaagggaaaggagcgtttcacagagcaaggggatgctattgta
tttgaatcagaagttgataaggtatatcttgctgcaccctcaaaagttgccattattgat
catgagaagaaaagaacatttgtcgtgacaaaagaaggactcccagatgctgttgtttgg
aatccttgggacaagaaggcaaaagctatgcaagattttggggatgcagaatacaagcac
atgctctgtgtggagcctgcagctgttgaaaagcctattaccctcaaacctggtgaagag
tggaaaggaagacttgcgctctcagctgttccttctagctactgcagcgggcagttagat
ccacaaagggtccttcatggttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system