KEGG   Brachypodium distachyon: 100823162Help
Entry
100823162         CDS       T01717                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bdi  Brachypodium distachyon
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100823162
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100823162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 361 aa AA seqDB search
MALESRLRLPLARPAPATAFLSGSVSKANHLPFSLKPASTSLSAANAPPPVVVVGSANAD
IYVEVDRLPLVGETVAARAGHSLAGGKGANQAACGGRLALGPTYLVARVGDDANGRLLEG
ALAHAGGVRLDRVARAPGAPSGHAVVMLMPDGQNSIIIVGGANMEGWATAVDPEDLDLIR
QAGVLLLQREIPDWVNIQVAQAAKGAGVPVILDAGGMDAPVPGELLGLVDIFSPNETELA
RLTGMPTETFEQINQAAGACHKMGVKEVLVKRGSQGSALFVEGEDPIRQPIIPATEVVDT
TGAGDTFTSAFAVALVEGKPKKECMRFAAAAASLCVRIKGAIPSMPDRNAVMSLLESAQV
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggctctcgaatcgcgcctccgcctcccactcgccagaccagctccggccaccgctttt
ctctcaggatccgtctctaaagccaaccacctacctttctccctcaaacccgcctccact
tctctctccgccgccaatgcgccaccgcccgtcgtcgtcgttggctccgccaacgccgac
atctacgtcgaggtcgaccgtctcccgctcgttggcgagacggttgccgcgcgtgccggc
cacagccttgcgggcgggaagggcgcaaatcaggccgcctgcggggggcggctcgcgctg
gggcccacctacctcgtggcccgcgtgggggacgacgccaacgggcgcctcctcgagggc
gccctcgcgcacgccggcggcgtccgcctcgaccgcgtcgcgcgcgcgcccggcgcgccc
tcgggccacgccgttgtcatgctcatgcccgacggacagaactccatcatcatcgttggc
ggcgccaacatggagggctgggccacggcggtcgacccggaggacctggacctgatccgt
caggctggcgtactactgctgcaacgggagatacccgactgggtcaacattcaggttgct
caggctgcaaaaggtgcgggtgtgcctgttatcttggatgcaggtgggatggatgctcct
gtccccggagaactacttgggctggtggatatttttagtccaaatgaaacggagctagca
cgcttgactgggatgcctacagagacgtttgaacagatcaaccaggctgcaggagcatgc
cataaaatgggtgtcaaagaagttttggttaaacgtggctcacaaggatctgcactgttt
gttgagggagaggacccaattaggcagcccataatacctgccacagaagttgtagatact
actggtgccggtgacaccttcacctcagcttttgccgtagctctggttgagggaaagcct
aagaaagagtgcatgagatttgctgctgctgctgcctcactgtgtgttcgaataaaggga
gccattcctagcatgcctgacaggaacgctgtgatgagccttctggaatctgcgcaagtt
gaataa

DBGET integrated database retrieval system