KEGG   Brachypodium distachyon: 100823399Help
Entry
100823399         CDS       T01717                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 5
Organism
bdi  Brachypodium distachyon
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 916 aa AA seqDB search
MEMVVSAPPPELLPEEEMALIRDITVAAESQAKEGDVFFLITNRWWQSWIDYVIQDSAGV
TSNGYHHHEFGSNAPRRPGAINNTDLLDDLAYEVSNMDMELHDTLVEGRDYILLPQQVWE
KLHGWYGGGPTLPRKAINTGLSQTDLAIEVYPLRLQLLLMPKGEQAVIRISKKDIVGELH
KKACEVFDLVPDEVCIWDYYGRKKHALMDNLEKTLDDANIQMDQDILVEVSTDANGIFDG
GCMSSIQENDFFERASSLMADASKSGLSSENLASINYASRSYSSGLPQNQCPRSSNGDSE
NVPGTVGVTTRGSPSGLTGLLNLGNTCFMNSAVQCLVHTPEFARYFREDYHCEINWNNPL
GMVGELALAFGELLRKLWSPSRTPVSPRPFKTKLSRFAPQFSGYNQHDSQELLAFLLDGL
HEDLNRVKHRPYLKSNDADGRSDEEVADEYWANHIARNDSIIVDVCQGQYKSTLVCPICG
KVSVTFDPFMYLSLPLQFASTRSMTVVVFTCDGSAPPTPYTVSVPKQGRCRDLIQALSSA
CSLKNEEKLLIAEIRNHRVHLFLEDPVLQLSTIKDDDHLAVYRLPKLEKRASYIQFVHRR
EELDHGNNSSSMSWKPYGVPLLAQIPRNETVTGSAIHEMGRKMLVPMLRNQVAQHTAVQS
SLSTRTQSYHTDGSKFQLQLNDDSNTVIEQTDYAIRVPQSSLATIIFVNWSKSDLKKLNT
NHLENLPEVFKYAPPAKRTRGEPLSLYACLDAFLREEPLVPEEMWYCPRCKEQRQASKKL
DLWRLPEVLVIHLKRFSFSRSTKHKLETFVNFPIHDLDLTNYIANKKISQRQIYELYAVS
NHYGSMASGHYTANIKLLDENRWYNFDDSHVSAINEEDVKSGAAYVLFYRRVRELDGAAS
NGTQSCVKRNHRSSQR
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggagatggtggtgtcggcgccgccgccggagctgctcccggaggaggagatggcgctc
atccgagacatcaccgtcgccgcggagtcccaagccaaggaaggcgacgtcttcttcctc
atcaccaacaggtggtggcaaagttggattgattatgtcattcaagattcagctggtgta
acaagtaatggttatcatcatcatgagttcggttcaaatgctccaagaaggccaggagct
attaacaatacagatttgctggatgatttggcatatgaagtttccaatatggatatggag
ctacatgataccttggttgaaggccgcgactatatattgctacctcagcaagtctgggaa
aagctgcatggttggtatggtggaggaccaacattaccaagaaaggcaatcaatactggc
ttgtcccaaactgatctagccatagaagtttatcctttacgtctgcagttacttctgatg
ccaaaaggagagcaagcggttataaggataagcaagaaggatatagttggtgaactccat
aagaaggcttgtgaggtttttgatttggtaccagatgaggtgtgcatttgggactactat
ggtcggaaaaagcatgctctgatggataacttggagaagacgcttgatgatgccaacatt
cagatggatcaagatattctagttgaggtttctactgatgcaaatggtatttttgatggt
ggatgcatgagttcgatccaagaaaatgatttttttgaacgagcatcttctttgatggca
gatgcctcgaaatcaggattgtcaagtgagaatttagcatcaattaattatgcttctaga
agctatagctctggtctccctcaaaaccagtgcccacggtcttccaatggtgactcggag
aatgtgcctggtactgttggtgtgaccacccggggatctccttcaggtcttacagggcta
cttaacttgggaaatacatgtttcatgaacagcgccgtgcagtgtcttgtgcacacacca
gagtttgctagatatttccgtgaagattaccactgtgaaattaattggaacaatccactt
ggcatggtgggtgaacttgcgctagcttttggtgagctactgaggaaactttggtctcct
agccgtaccccagtttcgccccgaccatttaaaacaaagctttctcggtttgcacctcag
ttcagtggatacaatcagcatgattcacaggagctgttggcattccttctggatggacta
catgaagacttgaaccgtgtgaaacatagaccttacttaaaatctaatgatgctgatgga
cgatcagatgaagaggttgctgacgagtattgggcaaatcatattgccagaaacgactct
atcattgttgatgtatgccagggacagtacaagtcaactttggtctgcccaatctgtgga
aaggtgtcagtgacttttgatcccttcatgtatctttccttgcccctacaatttgcttca
acacgaagcatgaccgttgtggtcttcacatgtgatgggagtgctccaccaacaccatac
actgtaagtgtaccgaagcaaggtaggtgcagagatcttatccaagccctcagcagtgca
tgctcgcttaaaaatgaagagaaacttctaattgcagagatacgtaatcatagggtccat
ctttttcttgaggatcctgtgcttcagctgtctacaattaaagatgatgatcatctggca
gtttatagacttccaaaattggaaaaaagggcaagctatattcaatttgtgcatcgtcgt
gaagaactggatcatggaaacaatagcagctcaatgtcttggaaaccatatggtgttcct
cttctagcgcaaatacctcgcaatgaaactgtcacgggatcagccatccatgagatgggt
cgtaaaatgcttgttcccatgttaagaaatcaggtggcacaacatacggcagttcaaagt
tctctttccacaagaacacaaagctaccataccgacggcagcaaatttcagctacagttg
aatgatgatagtaacacagttattgagcaaacagattatgctatcagggttccacagtct
tcgcttgcaactataatatttgtcaactggtccaagtcagatcttaaaaaattgaacact
aatcatttggagaaccttcctgaggttttcaaatatgcaccacctgccaagaggacacgt
ggtgaacctctatcgctctatgcatgcttggatgctttcttgagagaagaaccacttgtt
cccgaagaaatgtggtactgtccgagatgcaaggagcaaaggcaagccagtaaaaagctt
gatttgtggaggctaccagaagtgttggttattcatttgaagagattctcatttagtagg
tcaactaagcataaactagaaacttttgttaacttcccaatacatgacttggatttgaca
aactatattgctaacaagaagatctcgcaacgacaaatatatgagttgtatgctgtgagc
aatcattatggcagcatggcaagtgggcattatacggccaacataaagctcttggatgag
aaccggtggtataatttcgatgatagccatgtttctgccatcaacgaagaagatgtgaag
tctggtgcagcctatgtgctgttctacagaagagttcgagagctagatggggcagcaagc
aatggaacccagtcatgcgtgaaacgaaaccacagatctagccaaagatag

DBGET integrated database retrieval system