KEGG   Brachypodium distachyon: 100823399Help
Entry
100823399         CDS       T01717                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 5
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100823399
Peptidases [BR:bdi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100823399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 916 aa AA seqDB search
MEMVVSAPPPELLPEEEMALIRDITVAAESQAKEGDVFFLITNRWWQSWIDYVIQDSAGV
TSNGYHHHEFGSNAPRRPGAINNTDLLDDLAYEVSNMDMELHDTLVEGRDYILLPQQVWE
KLHGWYGGGPTLPRKAINTGLSQTDLAIEVYPLRLQLLLMPKGEQAVIRISKKDIVGELH
KKACEVFDLVPDEVCIWDYYGRKKHALMDNLEKTLDDANIQMDQDILVEVSTDANGIFDG
GCMSSIQENDFFERASSLMADASKSGLSSENLASINYASRSYSSGLPQNQCPRSSNGDSE
NVPGTVGVTTRGSPSGLTGLLNLGNTCFMNSAVQCLVHTPEFARYFREDYHCEINWNNPL
GMVGELALAFGELLRKLWSPSRTPVSPRPFKTKLSRFAPQFSGYNQHDSQELLAFLLDGL
HEDLNRVKHRPYLKSNDADGRSDEEVADEYWANHIARNDSIIVDVCQGQYKSTLVCPICG
KVSVTFDPFMYLSLPLQFASTRSMTVVVFTCDGSAPPTPYTVSVPKQGRCRDLIQALSSA
CSLKNEEKLLIAEIRNHRVHLFLEDPVLQLSTIKDDDHLAVYRLPKLEKRASYIQFVHRR
EELDHGNNSSSMSWKPYGVPLLAQIPRNETVTGSAIHEMGRKMLVPMLRNQVAQHTAVQS
SLSTRTQSYHTDGSKFQLQLNDDSNTVIEQTDYAIRVPQSSLATIIFVNWSKSDLKKLNT
NHLENLPEVFKYAPPAKRTRGEPLSLYACLDAFLREEPLVPEEMWYCPRCKEQRQASKKL
DLWRLPEVLVIHLKRFSFSRSTKHKLETFVNFPIHDLDLTNYIANKKISQRQIYELYAVS
NHYGSMASGHYTANIKLLDENRWYNFDDSHVSAINEEDVKSGAAYVLFYRRVRELDGAAS
NGTQSCVKRNHRSSQR
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggagatggtggtgtcggcgccgccgccggagctgctcccggaggaggagatggcgctc
atccgagacatcaccgtcgccgcggagtcccaagccaaggaaggcgacgtcttcttcctc
atcaccaacaggtggtggcaaagttggattgattatgtcattcaagattcagctggtgta
acaagtaatggttatcatcatcatgagttcggttcaaatgctccaagaaggccaggagct
attaacaatacagatttgctggatgatttggcatatgaagtttccaatatggatatggag
ctacatgataccttggttgaaggccgcgactatatattgctacctcagcaagtctgggaa
aagctgcatggttggtatggtggaggaccaacattaccaagaaaggcaatcaatactggc
ttgtcccaaactgatctagccatagaagtttatcctttacgtctgcagttacttctgatg
ccaaaaggagagcaagcggttataaggataagcaagaaggatatagttggtgaactccat
aagaaggcttgtgaggtttttgatttggtaccagatgaggtgtgcatttgggactactat
ggtcggaaaaagcatgctctgatggataacttggagaagacgcttgatgatgccaacatt
cagatggatcaagatattctagttgaggtttctactgatgcaaatggtatttttgatggt
ggatgcatgagttcgatccaagaaaatgatttttttgaacgagcatcttctttgatggca
gatgcctcgaaatcaggattgtcaagtgagaatttagcatcaattaattatgcttctaga
agctatagctctggtctccctcaaaaccagtgcccacggtcttccaatggtgactcggag
aatgtgcctggtactgttggtgtgaccacccggggatctccttcaggtcttacagggcta
cttaacttgggaaatacatgtttcatgaacagcgccgtgcagtgtcttgtgcacacacca
gagtttgctagatatttccgtgaagattaccactgtgaaattaattggaacaatccactt
ggcatggtgggtgaacttgcgctagcttttggtgagctactgaggaaactttggtctcct
agccgtaccccagtttcgccccgaccatttaaaacaaagctttctcggtttgcacctcag
ttcagtggatacaatcagcatgattcacaggagctgttggcattccttctggatggacta
catgaagacttgaaccgtgtgaaacatagaccttacttaaaatctaatgatgctgatgga
cgatcagatgaagaggttgctgacgagtattgggcaaatcatattgccagaaacgactct
atcattgttgatgtatgccagggacagtacaagtcaactttggtctgcccaatctgtgga
aaggtgtcagtgacttttgatcccttcatgtatctttccttgcccctacaatttgcttca
acacgaagcatgaccgttgtggtcttcacatgtgatgggagtgctccaccaacaccatac
actgtaagtgtaccgaagcaaggtaggtgcagagatcttatccaagccctcagcagtgca
tgctcgcttaaaaatgaagagaaacttctaattgcagagatacgtaatcatagggtccat
ctttttcttgaggatcctgtgcttcagctgtctacaattaaagatgatgatcatctggca
gtttatagacttccaaaattggaaaaaagggcaagctatattcaatttgtgcatcgtcgt
gaagaactggatcatggaaacaatagcagctcaatgtcttggaaaccatatggtgttcct
cttctagcgcaaatacctcgcaatgaaactgtcacgggatcagccatccatgagatgggt
cgtaaaatgcttgttcccatgttaagaaatcaggtggcacaacatacggcagttcaaagt
tctctttccacaagaacacaaagctaccataccgacggcagcaaatttcagctacagttg
aatgatgatagtaacacagttattgagcaaacagattatgctatcagggttccacagtct
tcgcttgcaactataatatttgtcaactggtccaagtcagatcttaaaaaattgaacact
aatcatttggagaaccttcctgaggttttcaaatatgcaccacctgccaagaggacacgt
ggtgaacctctatcgctctatgcatgcttggatgctttcttgagagaagaaccacttgtt
cccgaagaaatgtggtactgtccgagatgcaaggagcaaaggcaagccagtaaaaagctt
gatttgtggaggctaccagaagtgttggttattcatttgaagagattctcatttagtagg
tcaactaagcataaactagaaacttttgttaacttcccaatacatgacttggatttgaca
aactatattgctaacaagaagatctcgcaacgacaaatatatgagttgtatgctgtgagc
aatcattatggcagcatggcaagtgggcattatacggccaacataaagctcttggatgag
aaccggtggtataatttcgatgatagccatgtttctgccatcaacgaagaagatgtgaag
tctggtgcagcctatgtgctgttctacagaagagttcgagagctagatggggcagcaagc
aatggaacccagtcatgcgtgaaacgaaaccacagatctagccaaagatag

DBGET integrated database retrieval system