KEGG   Brachypodium distachyon: 100823428Help
Entry
100823428         CDS       T01717                                 

Definition
uncharacterized LOC100823428
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 537 aa AA seqDB search
MTRIFVQRGSSSNSGRSGSQTPQQQQNQTSSSSAVREEELNVQPQLPELLASDDITEHLL
EGSESSSNKPSRLVDPVSESSSCSEERPTREKPPKDDFNVTDPAFLAELTGLQFSDKPEQ
ENSVQSGTGPSQMTGGASHPPPPPAPPPKPSSSNNGLRRMGSGSSNSVRIGSSRRPVAWP
PVAARTSASGSRPSSPRSLADCEGYNSADEQGPCYTSSYDDSEREHMFEHDLRRVKGLEI
RKMAEDGNCLFRAVADQVYGDPEAYDMARQMCVDYMERERDHFSQFMTEGFTSYCKRKRR
DKVYGNNIEIQAFAEMYNRPIHIYSYSTEPINIFQGSYNTDVPPVRLSYHHGNHYNSVVD
PRRQTVGAGLGFSSLRGTNNVDRDQVKAAIRAQQDQQIENALLAEGRLYSDLELTEQEIE
RMVMEASRAEYLNQQQVNFRDSSRSGAEPSSSAAITGSSGSATAADRSNENCFVLPDTVL
TRGMQLLLAMGFSYMQVMEAYSIFGEDVDSMICYLVEMGGTGPSAGGSNRRKGKAAE
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggatcttcgtgcagcgtggctcctcgtccaactctggtcgctcgggctcacag
acgccacagcagcagcagaaccagacatcatcatcatcagctgtccgggaggaggagttg
aacgtgcagccacagctgccggagctcttggcttcagatgatataactgagcatcttctt
gagggcagcgagagtagtagcaataagccttcgagactggttgatcctgtgtctgagagc
tcaagctgttcagaagagaggcctacaagggagaaacctcccaaagatgacttcaatgtg
actgatcctgctttcttggcggaattaacggggcttcagttttcggataagcctgagcag
gaaaattctgtacagtcaggcactgggccatcgcagatgaccggcggagcatcacaccca
ccgcctccaccagctccaccaccgaaaccatcatccagtaataatgggttgaggagaatg
ggatctggaagctcgaacagtgtgcggattggatcttcaagaaggccagtagcttggcca
ccagtggcagctcggacatctgcttcgggttctcggccttcttcacctaggtcgcttgct
gattgtgaagggtacaatagtgcagatgagcagggcccctgttacacctctagctatgat
gattcggaaagggagcatatgtttgagcatgacctaaggcgagtgaaagggttggagata
aggaagatggcggaagatgggaattgtctgtttagagctgttgccgatcaagtttatggt
gatccagaagcttatgacatggctaggcagatgtgtgttgattatatggaaagagaacgg
gatcatttctcccagttcatgaccgaaggttttacatcatactgtaagaggaaaagaaga
gataaggtatatggcaataatattgagatccaggcctttgctgagatgtacaatcgtcca
attcacatatattcttacagtacagagcccattaacatttttcaaggaagttataacaca
gatgttcctccagttaggttaagttaccatcatggtaatcattacaattcagttgttgat
cctcgccggcaaacagttggggcaggcctgggatttagctcccttagagggaccaacaat
gtcgacagggaccaagtgaaggctgcaataagagctcagcaagaccagcagattgagaat
gcacttttggcggaagggcggctctactctgatctggaattaaccgagcaggaaatagag
cggatggtgatggaggcctctagggcagagtatctgaaccagcaacaggttaacttcaga
gattcatcaaggtcaggggcagagccatcttcttctgccgcaattactgggtcgtctggt
tcggctacggcagcagatagaagcaacgagaattgctttgtgctcccggacaccgtgctg
actcgtggcatgcagttgctcctagcaatgggcttcagctacatgcaagtgatggaagcc
tacagcatattcggcgaggacgtggactctatgatctgctacctggtagagatgggaggc
accgggccttctgcaggtggcagcaatcgtcggaaaggaaaggctgctgagtaa

DBGET integrated database retrieval system