KEGG   Brachypodium distachyon: 100823700Help
Entry
100823700         CDS       T01717                                 

Gene name
MKK1.1, MKK1.2
Definition
(RefSeq) mitogen-activated protein kinase kinase 2
  KO
K20603  
mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
bdi  Brachypodium distachyon
Pathway
MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    100823700 (MKK1.1)
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100823700 (MKK1.1)
Protein kinases [BR:bdi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100823700 (MKK1.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 348 aa AA seqDB search
MRKPGKLALPSHESTIGKFLTQSGTFKDGDLLVNKDGLRIVHNSEEGEAPPIEPLDDHQL
SLDDLDAIKVIGKGSSGIVQLVRHKWTDQFFALKVIQLNIQESIRKQIAQELKISLSTQC
QYVVTCYQCFYVNGVISIVLEYMDGGSLADFLKTVRTIPEAYLAAIFKQVLQGLMYLHHE
KRVIHRDLKPSNILINHRGEVKISDFGVSAIIASSSAQRDTFTGTFNYMAPERISGQKHG
YMSDIWSLGLVMLECATGNFPYPSPDSFYELLEAVVDQPPPSAPTDQFSPEFCSFISACI
QKEATDRSSAQVLSDHPFLSMYDDLNIDLADYFTTAGSPLATFKQIVL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagccgggcaagctcgcgctcccgtcccacgagtccaccatcggcaaattcctg
acgcagagcgggacgttcaaggacggcgacctgctcgtcaacaaggacgggctccgcatc
gtgcacaactccgaggaaggcgaggctcctcctatagagccgttggatgatcatcaattg
agcctagatgatctagacgcaatcaaagtgatcgggaagggtagtagtggaatcgtgcaa
ctggttcgccacaaatggacagaccagttttttgctctgaaggttatacaactcaatatt
caggaaagcatacgtaaacagattgcccaggagttgaaaataagcttgtcaacacagtgc
caatatgttgtcacgtgctaccagtgtttttatgtcaatggtgttatttctattgttttg
gagtatatggatggtggctctctggccgatttcctgaagacagttagaaccattccggag
gcttaccttgctgcgatttttaagcaggtgttacagggactgatgtacttacatcacgag
aagcgtgttatacacagagatctgaaaccatcaaatatattgataaaccacaggggtgaa
gtaaagatatcagattttggtgttagtgcgatcattgctagttcttctgcgcagcgagat
acatttactgggacatttaactacatggcgccagaaaggatcagtgggcagaaacatggt
tatatgagtgacatctggagcctgggcctagttatgctggaatgtgccactggaaacttt
ccatatccgtctcctgatagcttttatgaactgcttgaagctgttgtcgaccaaccacca
ccttctgcaccaacagaccagttttcaccggagttctgttctttcatttctgcatgtatc
caaaaggaggctacagataggtcatctgcacaagtcttgtcagatcatccgttcctgagc
atgtacgacgacctgaatatagatcttgccgactacttcacgactgcaggatcgccactt
gccactttcaaacaaatcgtgttgtga

DBGET integrated database retrieval system