KEGG   Brachypodium distachyon: 100823965Help
Entry
100823965         CDS       T01717                                 

Definition
cell division cycle protein 27 homolog B-like
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
bdi  Brachypodium distachyon
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:bdi04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 721 aa AA seqDB search
METLMVDRVHSSLRLFMNRNAVFLCERLCAQFPAETNLQLLATCYLHNNQPYAAYHILKG
KKLSESRYLFAISCFRMHLLREAEETLCPVNEPNIEVPNGATGHYLLGLIYRYTGRVAAA
AEQFTQALTLDPLLWAAYEELCILGVAEDANECFSEATALRLQQEHTSTSNLEKSNFVNE
NRVLSSNVSASLVDISPKQIKQLHANNTAEIPGYPHVRATALHVQNSIPSNVGQFDSPSP
TVTQTSGIVPPPLFRNLHAYQNMTSGDAPAKPKVAVNQPLRRKYLDEARLKKVTGRLFNQ
SSDSVPRRSARLSRDTPINSNSNISQFGGNGTDHSSGSRYEAVDEMWTDNIAAPSSSVSI
VEGRCFEQDKAERILSQESKLATGIRELLGLLRTLGEGYRLSCLFKCQEALEVYRKLPEP
QFNTGWVLCQVGKAYFELVDYLEADHFFELAHRLSPCTLEGMDIYSTVLYHLNEEMRLSY
LAQELISVDRLSPQAWCAVGNCFSLRKDHETALKNFQRAVQLDSRVAYSHTLCGHEFSAL
EDYENSVKFYRCALQVDERHYNAWYGLGVVYLRQEKFEFAEHHFRRAFQINPRSSVLMCY
LGMALHALQRNEDALEMMDKAIFSDKKNPLPKYQKALILVGLQDYPEALDELERLREIAP
HESSMYALMGKIYKQLNILDKAVFCFGIALDLKPPAADLAIIKSAMEKVHLPDELMDDDD
L
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccctaatggtggaccgcgtccacagcagcctccgcctcttcatgaaccgcaac
gccgtcttcctctgcgagcgcctctgcgcccagttccccgccgagaccaacctgcagttg
ctagcaacttgctacctccacaacaaccagccctatgctgcataccacattctgaaaggt
aagaagctgtcggagtcccggtacttgtttgctatatcgtgctttcggatgcacctcctg
cgggaagctgaagaaactctgtgtccagtcaatgaaccaaacattgaggttccgaatggc
gcaacaggacattaccttcttggactaatatacaggtacacgggcagagtggcagctgca
gctgaacaatttacacaagctttgactctcgaccctcttctatgggcagcatatgaggaa
ttgtgtatactaggtgttgctgaagatgcgaatgaatgttttagcgaagcaactgctcta
cgtctccagcaggaacacacatctacatcaaatctggagaagtcaaactttgtcaatgaa
aatcgagttctttcttccaatgtgtcagcaagccttgtggatataagccctaagcaaata
aaacaactgcatgctaacaacacagctgaaatacctggttatcctcatgtaagagcaact
gcgttgcatgtgcagaacagtataccatctaatgtaggacagtttgacagcccatcacca
actgtaacacagacttctggtattgttccaccaccactctttaggaatctccacgcttac
cagaatatgacaagtggtgatgctccagccaaaccaaaggttgcagtgaaccaaccgcta
agaagaaaatacctggatgaagcaaggctgaagaaggttactggaaggctctttaatcag
agcagtgattcagtacctcgaagaagtgcaagactttctagagatactccaataaattca
aattcaaatatatctcagtttggaggaaacggaacagatcactcgtcaggaagcaggtat
gaagctgttgatgaaatgtggacagataatatagcagcaccctcatcttctgttagtata
gttgaaggaagatgttttgagcaagataaagctgagcgaatcctgtcgcaagagtccaaa
ttagcaactggtatcagggagctattgggacttttaaggacactcggagaaggctatagg
ttatcttgcttgtttaagtgccaggaagcactggaagtctacagaaaactcccagagcca
caatttaatactggatgggttctgtgccaggtggggaaggcatactttgaattggttgat
tatctagaagctgaccatttctttgagttagcacatcgactatcaccgtgcacgctggag
ggaatggacatctactccactgttctttatcacttgaacgaggaaatgaggctaagttac
cttgctcaggagctaatttctgttgatcgactgtctcctcaagcatggtgtgcggttgga
aattgcttttccttgcggaaagaccacgagactgctttgaaaaacttccagcgtgctgtg
caacttgactcgagagttgcttactctcacactctatgcggtcacgagttttctgcatta
gaggactacgagaacagtgttaaattctaccgatgtgcacttcaggtagatgaaaggcac
tacaacgcctggtatgggcttggagtggtgtaccttcgccaagaaaagtttgagtttgct
gagcatcatttcagaagggcatttcagataaaccctcgctcttcggttcttatgtgctat
cttgggatggccttacatgctctacagaggaatgaggatgctttggagatgatggataaa
gctatattttctgataagaagaatccacttcccaagtatcagaaggctttaatcctggta
ggccttcaagattatccggaagctctggatgagttggagcggctaagggagattgcacct
catgagagtagtatgtatgcacttatggggaagatatacaagcaactgaatattcttgac
aaggctgtattttgctttggcattgccctggatttgaaacctcctgctgctgaccttgct
ataatcaagtctgcaatggagaaagtacacctaccagatgaactgatggatgatgatgac
ctgtaa

DBGET integrated database retrieval system