KEGG   Brachypodium distachyon: 100824458Help
Entry
100824458         CDS       T01717                                 

Definition
uncharacterized LOC100824458
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100824458
Protein kinases [BR:bdi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   100824458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 923 aa AA seqDB search
MEASARQEDAAPPWMPSETSAFRPFVGSAEASPSASGNGVAPHISNLHGVKRKPSVAKLT
SDIVRTFERCDPRFKYSEALNPKRFLTHPSTPAHNDGADNSNWDLILYVNLELVNTTSKR
RFIVKEMLGQGTFGQVVKCWDTETSDYVAVKVIKNQPAFYQQAITEVSLLRTLNQDFDPD
DRHNIVRMLDYLSFQNHLCIAFEMLGQNLYELLKRNHLRGLNVKYVHAFSKQILDAMIVM
RDGGIIHCDLKPENILLAPTVKTAAAVKVIDFGSACMEGKTVYAYIQSRYYRSPEVLIGY
PYTTAIDMWSFGCIVAELFIGLPLFPGASEYDVLKRMLKILGGQPSDDLLREAKNTGRFF
KHVGHIYLGSRAHEGLGSAYKMLSEEEVEGRESNRPKLGKWYFPQLRLDQLLYTYPWDNT
ELSDTEKADRTVLVDFLRGLLEFDPNKRWSPLQASGHPFITGEPFTGPYEPVPETPRIPV
ARAAAVDHNPGGGHWLVAGLSPQVGSANRCLPLNPYPQQMPFSYGSSYGSFGSHGSYAGN
AGHASSYGSYGDVNNVNMYYSPLGPSGFSHVGSSPDIRLRPRISYDRGIRLSPGSMGPMS
LGASPSQFTPPNYQMQIPANSTGKHGSGSPATGSIHGSPLGKATLTGQYSKRKSLPMLPR
EYTSQHGQGRHGDGVSFSHSDAYVRGHAGYSQHALPSSGHSSWRPQIGSGSGFSLEASSS
HGPSQAFHSHNAPTLPSFDTIPDTSAPSTLDPADWDPNYSDESLLQEDNSLSADLSSSLH
LRDAATGQPSGSARSGHVQSHNFASSNPLPTSQSYRADQQFHSSSLRGGTRPTVPITYGG
YNAPSYPQQNHRSRHGQQFHQQRYNQSTNSQMRPPVGSHQSGQPAWPPYGVGDGVPWGGT
GVHPFTTSGLPSSLRRKDYGSIF
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgagcgccaggcaggaggacgcggcgccgccgtggatgcccagcgagacctcg
gcgttccggcctttcgtgggttccgcggaggcgtccccatcggcctcgggcaatggtgtt
gccccccacataagcaaccttcatggtgttaagaggaaaccgtctgttgcaaaattaaca
tcagacatagttcgaacttttgaaagatgtgaccctcggtttaagtactcagaagcgcta
aacccaaagcgctttctcacccatccttcaacgccagctcacaatgatggagctgacaat
tcaaactgggatctcatattgtatgtcaacctggaattggtcaacacgacatcaaagcga
aggttcattgtcaaggaaatgcttggccaaggtacgtttggccaagttgtcaaatgctgg
gacacagaaaccagtgactatgtcgctgtgaaggttataaaaaaccaacctgcgttttat
caacaggcgatcaccgaggtctcactgttgagaacgctaaatcaggattttgatcctgat
gatcggcataacattgttcgaatgctcgattatctctcatttcaaaatcacctgtgtatt
gcctttgagatgcttggtcaaaacctgtacgagctgttgaaaaggaatcatttaagaggc
ctgaatgtgaaatatgtacatgccttctccaaacagatattggatgcaatgattgtgatg
agagatggcggcatcattcactgtgatctaaaacctgaaaatatcctcttagctccaact
gtcaagacagctgcagcagtgaaagttattgattttggatcagcatgcatggagggtaaa
acagtgtacgcatacattcagagccgctattacagatctccagaagttctcattggctat
ccatacactactgcgattgatatgtggtcattcggttgcatagttgccgaactgtttata
ggattacccttatttcctggagcatcagaatatgatgtgcttaagcgtatgctgaagatt
ctcggggggcaaccatcagatgacttgctaagggaagctaaaaatactggacggtttttt
aaacatgttgggcatatttatctgggtagcagggcacacgaaggccttggcagtgcatac
aaaatgttaagtgaagaagaggtcgagggaagggagtccaataggccaaaattagggaaa
tggtacttcccacaactaaggctggaccagctattatatacctatccttgggataataca
gaattgtcagacacagaaaaagcagatcgcacagtattagttgatttcttgaggggactt
cttgaatttgacccaaataagcgatggtcgccattgcaggcatcaggccatccattcatt
acaggtgaacctttcactggtccatatgagcctgtcccagagactccaagaattcctgtt
gctcgtgctgcagctgttgatcacaatccaggaggcggccactggttagttgcaggtctt
tccccccaggttggaagtgcgaacagatgtctacctcttaacccctatcctcaacaaatg
cctttttcctatgggagtagttatggaagctttggtagccatggcagctatgctgggaat
gccggtcatgctagcagttatggaagctatggtgatgttaataatgtcaacatgtattac
tctccattagggccttctggattttcacatgttggctctagtccagatattagactgaga
cctcgtatctcatatgatagaggcattcgattaagccctggaagtatggggcctatgtct
ctcggtgccagtccatcacaatttacccctccaaactaccagatgcaaatcccagctaat
tctactgggaagcatggttctggttctcctgcgactggaagcattcatggctccccattg
ggaaaagctacactaacaggccaatacagcaagaggaagagcttgccgatgctaccacgt
gaatatacatctcagcatggacaaggacgacatggagatggtgtcagttttagtcattct
gatgcctatgttcgaggacatgctggctactctcagcatgcattacctagttctggtcat
tctagttggagacctcaaataggttctggaagtggtttttccttggaggcttcttctagt
catggaccttctcaagcattccattcgcataatgctcctactttaccctcatttgacact
ataccagatacatcagctccatcaacacttgatcctgctgattgggaccctaattatagt
gacgagtcactattgcaagaagacaattcactgtcagctgatttaagcagcagccttcat
cttagagatgctgcaaccggtcagcccagtggatctgccagatcaggccatgtccagagc
cacaacttcgcaagctcaaaccctttgccaacaagccaaagctacagagctgatcaacaa
tttcattcatcctccctccgagggggcactcgtcctactgttccaatcacctatggtggt
tacaacgcaccgagttatcctcagcaaaatcaccgcagtcggcatggccagcaatttcac
cagcaaagatacaaccagtcaactaacagtcaaatgcgaccgccagtggggagtcaccaa
agtgggcagcctgcgtggcctccctatggcgtgggtgatggagtgccctggggtggaact
ggtgtgcatccatttacgactagcgggctaccgtcatcgcttcggagaaaagattacggg
agcatattctag

DBGET integrated database retrieval system