KEGG   Brachypodium distachyon: 100824469Help
Entry
100824469         CDS       T01717                                 

Definition
histidinol dehydrogenase, chloroplastic-like
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bdi  Brachypodium distachyon
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bdi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bdi00340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 491 aa AA seqDB search
MPPLPNPVACLGLRGSAAAAAATPSRCRAAPQPALYVSRLPPHASASTAVSIVSCAMKSY
RLSRLSDAEISGLKARPRIDFSSIFTTVNPIVEDVRVRGDAAVKDYTEKFDKVVLDNAVV
RVSDLPDAELDPAVKEAFDVAYDNIYAFHISQKLPEKTIENMKGVRCKRITRCIGSVGLY
VPGGTAVLPSTALMLAVPAQIAGCKTVVLATPPSRDGSICKEVLYCAKKAGVTHILKAGG
AQAISAMAWGTASCPKVEKIFGPGNQYVTAAKMILQNSEAMVSIDMPAGPSEVLVIADKY
ANPVHVAADLLSQAEHGPDSQVVLVIAGDFVDLSAIQAEISKQCSALPRGEFASKALGHS
FTVFAKDMAEAISFSNMYAPEHLIINVKDAEQWEELIENAGSVFLGPWTPESVGDYASGT
NHVLPTYGYARMYSGVSLNSFLKYITVQSLTEEGLRTLGPFVAKMAEVEGLEAHKRAVTL
RLQEIEANVTV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcctccactccccaaccccgtcgcttgtcttggtcttcgagggagcgccgccgccgcc
gccgccaccccatcccggtgccgagcagcgccccagcccgctctctacgtctctcgtctt
cctcctcatgcgagcgcctccaccgcagtttcgattgttagctgcgcgatgaagtcgtac
cggctgtccagactcagcgacgccgaaattagcggcctcaaggcacgccctcgcatcgac
ttctcctccatcttcaccacggtgaatcccattgtcgaagatgtgcgtgtcagaggagat
gctgcggttaaggactatacggaaaagtttgacaaggtcgtactcgacaatgcggtcgtc
cgtgttagcgatcttccggatgcagagcttgatccagctgtaaaggaggcctttgacgtg
gcgtatgacaatatttacgccttccatatttcacaaaagttgcctgagaagacgattgag
aatatgaaaggtgtaagatgcaaaaggataacaagatgcattggttctgtcgggctgtat
gttccaggtggtactgcagtcttgccttcaactgcattgatgcttgctgtgcctgcacag
attgctggatgcaaaactgtagttcttgccacaccccccagtcgtgatggtagcatatgt
aaggaggttctttactgtgcaaaaaaagctggcgttacacacatattgaaagctggggga
gctcaggcaatctcagctatggcgtggggaactgcatcatgcccaaaggttgagaaaatc
tttgggcctggtaaccagtatgtcactgctgcaaaaatgattcttcagaacagtgaagct
atggtctctatagacatgcctgctggcccttcagaagttctggtcattgcagataaatat
gcaaaccctgttcatgttgccgctgatcttctatctcaggcagaacatggccctgatagt
caggttgttctagttatcgcgggagattttgttgatttgagtgccattcaagcagaaatt
agcaagcagtgcagtgctcttcctagaggagaatttgcttccaaagcacttggccacagt
ttcactgtgtttgccaaagatatggctgaggcaatatcgttctcaaatatgtatgctccc
gagcatttgatcatcaatgtaaaggacgccgagcaatgggaggagctcatcgagaatgca
ggttcagttttcttggggccatggacaccggagagcgtgggcgactatgctagcgggacg
aaccatgtccttccaacctacggttacgcaaggatgtacagcggcgtgtcactgaactcc
ttcctcaaatacatcaccgttcagtccctgactgaggaagggctgaggacgctgggtccg
ttcgtcgcgaagatggcggaagtggaagggctagaggcgcacaagagagctgtcactctc
aggctgcaagagatcgaggccaatgtaactgtgtag

DBGET integrated database retrieval system