KEGG   Brachypodium distachyon: 100824469Help
Entry
100824469         CDS       T01717                                 

Definition
histidinol dehydrogenase, chloroplastic-like
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bdi  Brachypodium distachyon
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100824469
  Amino acid metabolism
   00340 Histidine metabolism
    100824469
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     100824469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 491 aa AA seqDB search
MPPLPNPVACLGLRGSAAAAAATPSRCRAAPQPALYVSRLPPHASASTAVSIVSCAMKSY
RLSRLSDAEISGLKARPRIDFSSIFTTVNPIVEDVRVRGDAAVKDYTEKFDKVVLDNAVV
RVSDLPDAELDPAVKEAFDVAYDNIYAFHISQKLPEKTIENMKGVRCKRITRCIGSVGLY
VPGGTAVLPSTALMLAVPAQIAGCKTVVLATPPSRDGSICKEVLYCAKKAGVTHILKAGG
AQAISAMAWGTASCPKVEKIFGPGNQYVTAAKMILQNSEAMVSIDMPAGPSEVLVIADKY
ANPVHVAADLLSQAEHGPDSQVVLVIAGDFVDLSAIQAEISKQCSALPRGEFASKALGHS
FTVFAKDMAEAISFSNMYAPEHLIINVKDAEQWEELIENAGSVFLGPWTPESVGDYASGT
NHVLPTYGYARMYSGVSLNSFLKYITVQSLTEEGLRTLGPFVAKMAEVEGLEAHKRAVTL
RLQEIEANVTV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcctccactccccaaccccgtcgcttgtcttggtcttcgagggagcgccgccgccgcc
gccgccaccccatcccggtgccgagcagcgccccagcccgctctctacgtctctcgtctt
cctcctcatgcgagcgcctccaccgcagtttcgattgttagctgcgcgatgaagtcgtac
cggctgtccagactcagcgacgccgaaattagcggcctcaaggcacgccctcgcatcgac
ttctcctccatcttcaccacggtgaatcccattgtcgaagatgtgcgtgtcagaggagat
gctgcggttaaggactatacggaaaagtttgacaaggtcgtactcgacaatgcggtcgtc
cgtgttagcgatcttccggatgcagagcttgatccagctgtaaaggaggcctttgacgtg
gcgtatgacaatatttacgccttccatatttcacaaaagttgcctgagaagacgattgag
aatatgaaaggtgtaagatgcaaaaggataacaagatgcattggttctgtcgggctgtat
gttccaggtggtactgcagtcttgccttcaactgcattgatgcttgctgtgcctgcacag
attgctggatgcaaaactgtagttcttgccacaccccccagtcgtgatggtagcatatgt
aaggaggttctttactgtgcaaaaaaagctggcgttacacacatattgaaagctggggga
gctcaggcaatctcagctatggcgtggggaactgcatcatgcccaaaggttgagaaaatc
tttgggcctggtaaccagtatgtcactgctgcaaaaatgattcttcagaacagtgaagct
atggtctctatagacatgcctgctggcccttcagaagttctggtcattgcagataaatat
gcaaaccctgttcatgttgccgctgatcttctatctcaggcagaacatggccctgatagt
caggttgttctagttatcgcgggagattttgttgatttgagtgccattcaagcagaaatt
agcaagcagtgcagtgctcttcctagaggagaatttgcttccaaagcacttggccacagt
ttcactgtgtttgccaaagatatggctgaggcaatatcgttctcaaatatgtatgctccc
gagcatttgatcatcaatgtaaaggacgccgagcaatgggaggagctcatcgagaatgca
ggttcagttttcttggggccatggacaccggagagcgtgggcgactatgctagcgggacg
aaccatgtccttccaacctacggttacgcaaggatgtacagcggcgtgtcactgaactcc
ttcctcaaatacatcaccgttcagtccctgactgaggaagggctgaggacgctgggtccg
ttcgtcgcgaagatggcggaagtggaagggctagaggcgcacaagagagctgtcactctc
aggctgcaagagatcgaggccaatgtaactgtgtag

DBGET integrated database retrieval system