KEGG   Brachypodium distachyon: 100824513Help
Entry
100824513         CDS       T01717                                 

Definition
histone acetyltransferase GCN5-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100824513
Transcription machinery [BR:bdi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100824513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 507 aa AA seqDB search
MDGLAAPSPSHSGATSGGVASHRKRKLPPPSLSDATGDEDDDTTAPSSPATSPSSPSHPS
SPSSSHSDEDDDDSLTTFTAARLDAVPTSSSGRPPKPDSSSASAVAAAAAPKPDATSAAA
GDGKEDSKGLFTDNIQTSGAYSAREEGLKREEDTGKLKFLCYCNDGVDEHMIWLVGLKNI
FARQLPNMPKEYIVRLVMDRTHKSMMVIRNNNVVGGITYRPYVSQRFGEIAFCAITADEQ
VKGYGTRLMNHLKQHARDADGLTHFLTYADNNAVGYFVKQGFTKEITFDKERWHGYIKDY
DGGILMECKIDQKLPYVDLATMIRRQRQAIDEKIRELSNCHIVYSGIDFQKKEAGIPRRL
MKPEDIPGLKEAGWTPDQWGHSKSRLSFSSDYNTYRQQLTSLMRLLLKNLLDHADAWPFK
EPVDSRDVPDYYEIIKDPIDLKTMSRRVESEQYYVTLEMFVADLKRMFVNARTYNSPDTI
YFKCSTRLEAYFTSRIQAHLAQTSTKN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggacggcctcgccgcgccctcgccctcccactccggtgccacctcgggcggtgtcgcc
tctcaccgtaagcggaagctcccgccgccttccctctctgacgccaccggtgacgaggac
gacgacaccaccgcgccgtcgtcgcccgccacttccccatcctcgccctcgcacccgtca
tctccgtcctcctcccattccgacgaagatgacgacgactcccttaccaccttcaccgcc
gcccgcctcgacgccgtgccgacctcctcctccggcaggccccccaagcccgattcctcg
tccgcatctgccgtcgcagcggcggcggctcccaagcccgacgccacgtccgcggcggcc
ggcgacgggaaggaggactccaaagggctgttcacggacaatatccagaccagcggcgcc
tacagcgcccgcgaggagggcctcaagcgcgaggaagatacagggaagctgaaatttctc
tgctattgtaacgatggagttgatgaacatatgatttggttggtaggtttgaagaatatc
tttgcgcggcagctccctaatatgccaaaagagtatattgtccgacttgttatggataga
actcacaagtcaatgatggttatcaggaataataatgttgtaggaggcattacttaccgc
ccttatgtaagccagaggttcggagaaatagcattttgtgcaattacagccgatgagcaa
gttaaaggctacggaacaaggttaatgaatcatctgaagcaacatgcccgagatgctgat
ggtctcactcatttcttaacttatgctgataacaatgctgttggctattttgtaaagcag
ggtttcacaaaggagatcactttcgacaaagaaagatggcatgggtacatcaaggactac
gatggaggaatattaatggaatgcaaaattgatcaaaagctgccatatgttgatctggca
acaatgattcgtcgtcaaaggcaggctattgatgagaagatcagagagctttcgaactgc
catattgtttattcaggaattgattttcaaaagaaagaagctggtattccaagaagactg
atgaaaccagaagatatccctggtctgaaggaagctgggtggactcctgatcagtgggga
cattccaaatcacgtttatcattttcctcggattacaatacttacagacagcagctcact
agccttatgcggttgttgttgaagaatttgcttgatcacgctgatgcttggccgttcaaa
gaaccggtggattcacgtgatgttccagattattatgaaattatcaaggatcctatcgat
ttgaagacaatgtcaagaagagttgaatcggagcagtattatgtcactttagagatgttt
gtagctgacttgaagagaatgtttgtcaatgcgagaacttacaactctcctgatacgata
tatttcaaatgctccacgaggttagaggcctacttcacaagcagaatccaagctcacctt
gcccagacctcaaccaagaactag

DBGET integrated database retrieval system