KEGG   Brachypodium distachyon: 100824575Help
Entry
100824575         CDS       T01717                                 

Definition
magnesium-chelatase subunit chlD, chloroplastic-like
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100824575
Enzymes [BR:bdi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     100824575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 758 aa AA seqDB search
MAMATALSTSLPHLPPRHRLPSSHPAAVSLPSRGVRRREAPRLAAVAAASEVLDSTNGAV
PSPSSGVDTGRQYGREYFPLAAVVGQDAIKTALLLGAIDREVGGIAISGKRGTAKTVMAR
GLHAMLPPIEVVVGSISNADPNIPEEWEDDLADQVQYDADGNVKSEIVKAPFVQIPLGVT
EDRLIGSVDVEASVRSGTTVFQPGLLAEAHRGVLYVDEINLLDEGISNLLLNVLTEGVNI
VEREGISFRHPCKPLLIATYNPEEGSVREHLLDRIAINLSADLPLSFDDRVAAVNIATQF
QESSKDVFKMVEEETEVAKTQIILAREYLRDVAISTEQLKYLVTEAIRGGCQGHRAELYA
ARVAKCLAAMEGREKVYVDDLKKAVELVILPRSIISDNPQDQQNQPPPPPPPQPPQNQDS
AEDQDEKEEDEDKEEEKEDDDEENEQQDDQIPEEFVFDAEGGLVDDKLLFFAQQAQRRKG
KAGRAKNVIFSEDRGRYIKPMLPKGPVRRLAVDATLRAAAPYQKLRREKDLNKTRKVFVE
KTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVSIIPFRG
DFAEVLLPPSRSIAMARKRLEKLPCGGGSPLAHGLSTAVRVGLNAEKSGDVGRIMIVAIT
DGRANVSLKKSNDPEAAAASDAPRPSTQELKDEILEVSAKIYKAGMSLLVIDTENKFVST
GFAKEIARVAQGKYYYLPNASDAVISAATKTALADLKS
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggccaccgccctctctacctcactcccgcacctcccgccccgccaccgcctc
ccctcgtcacaccccgctgcagtctccctgccctcccgcggcgtccggcggcgagaggcc
ccccgcctcgcggccgtcgcggcggcatccgaggtcctcgactccaccaacggcgccgtt
ccctcgccgagtagcggcgtcgacaccgggcggcagtacgggcgggagtacttcccattg
gccgctgtcgtcgggcaggatgcaattaaaactgctttgctgcttggggcaattgatcgt
gaagttggaggcattgccatctccgggaagcgcgggacggctaagacagtgatggctcgt
ggcttgcatgctatgcttccacccatcgaggtggtagtaggctcaatttcaaatgctgac
cccaacatcccagaagaatgggaggatgatttagctgaccaagttcagtatgatgctgat
ggtaatgtcaagtctgagattgttaaagcaccttttgtgcagattccacttggtgtcaca
gaggacaggcttattggatcagttgatgttgaagcatcagtgagatcaggaactaccgtg
tttcaacctggtcttcttgccgaagcccatagaggtgttctttatgttgatgagataaat
ctgttggatgagggcataagcaatctgcttctgaatgtcttgacggagggagttaatatt
gtggaaagagagggcattagcttccgtcatccatgcaaaccacttctaattgctacttac
aacccggaggaaggatctgtacgtgaacacttacttgatcgtattgcaattaatttaagt
gctgaccttccattgagctttgatgaccgtgtggcggctgtcaatattgcaacccaattt
caggagtctagcaaagacgtttttaagatggtcgaagaagaaacggaggttgcaaaaact
cagataattttggcaagagagtatttgagggatgttgctatcagcacggagcagctcaaa
tatcttgtcacggaagctatacggggcggctgtcaggggcaccgtgctgagttgtatgct
gctcgtgtagcaaaatgtctcgctgccatggaaggacgtgaaaaagtttacgtggatgac
ctcaagaaagctgtagagctagttattctacctcgctcgatcatatctgataacccacag
gaccagcaaaaccaaccacctccacctccacctccacaacctccacaaaatcaagattct
gcagaagatcaagatgagaaggaggaagatgaggataaggaagaggaaaaggaggacgat
gatgaagaaaacgaacaacaggatgaccagatacccgaggagttcgtttttgatgctgaa
ggtggactagtagatgataagctccttttctttgctcagcaagcacaaagacgaaaagga
aaggctggacgagcaaaaaatgtcatattctcagaagacaggggccggtacatcaagcct
atgcttccaaagggtccagtaaggaggttagctgttgatgcgacacttcgagcagctgcg
ccataccaaaagctgcggagagagaaagatcttaacaagacaagaaaagtttttgttgaa
aagactgacatgagagccaaaagaatggctcgaaaagccggtgctctggtgatatttgtt
gtggatgctagtggcagcatggctctgaatcgcatgcagaacgcgaaaggggcggcattg
aagttgcttgcagaaagttacacaagtagagatcaggtttcaattattcctttccgtgga
gattttgctgaggttctacttccgccatcaagatccatagcaatggcacgcaaacgtctt
gaaaagctaccatgtggtggtggttctcctttagctcatggcctcagtacagctgtcaga
gtggggttgaatgctgagaagagtggcgatgttggacgtattatgatcgttgcaattacc
gatggaagagctaatgtatcactgaagaaatccaatgatccagaagctgctgctgcttca
gatgcaccaagaccttctactcaagaattaaaggatgagattcttgaggtgtctgccaaa
atatacaaggcaggaatgtcacttcttgtcattgatactgagaacaagtttgtatctacg
ggattcgccaaggaaattgcaagggttgcccaagggaaatattattacctgccaaatgct
tcggacgccgtgatttccgctgccaccaagactgcgctcgcggatttgaagagttag

DBGET integrated database retrieval system