KEGG   Brachypodium distachyon: 100824660Help
Entry
100824660         CDS       T01717                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 1, mitochondrial
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00020  Citrate cycle (TCA cycle)
bdi00310  Lysine degradation
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100824660
  Amino acid metabolism
   00310 Lysine degradation
    100824660
Enzymes [BR:bdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100824660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 RnfC_N GCV_H
Motif
Other DBs
NCBI-GeneID: 100824660
NCBI-ProteinID: XP_003562264
UniProt: I1GQ82
Position
1
AA seq 438 aa AA seqDB search
MASRIAARLLLRRPTAALSFLQSCRHARHFSTQLLEGVPRFSKPTRARYFLPNASPYQLW
SRSFASENGDLIEAVVPFMGESVTDGTLANFLKKPGDRVEADEAIAQIETDKVTIDVSSP
EAGVIEKFIASEGDTVTPGTKIAVISKSAAPSETHVSPSEETSQKETPPPPPPEKPKVEE
KSSKVESVKPKASKLSSPSEPQLPPKERERRVAMPRLRKRIANRLKDSQNTFAMLTTFNE
VDMTNLMKLRSDYKDEFVEKHGVKLGLMSCFVKAAVSALQNQPIVNAVIDGDDIIYRDYI
DISVAVGTSKGLVVPVIRDTEGMNFADIEKGINKLAKKATEGALSIDEMAGGTFTISNGG
VYGSLISTPIINPPQSAILGMHSIVQRPVVVDGSILARPMMYLALTYDHRLIDGREAVLF
LRRIKDVVEDPRRMLLDI
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccgaatcgcggcccgcctcctcctccgccgcccaactgccgcattaagtttt
cttcagagttgtaggcatgctaggcatttcagcactcagttactcgaaggtgttccgaga
ttctcaaagccaacacgtgcacgctatttccttccaaatgcttctccatatcaactttgg
agtagatcatttgcttcagaaaatggtgacttgattgaggctgttgtgcccttcatgggt
gaatctgtaactgatggaacccttgccaatttcttgaagaaacctggtgatagagttgaa
gctgatgaggctatagcgcagattgaaactgataaggttaccatagatgtttctagtcca
gaagctggggtgattgaaaagttcattgccagtgaaggtgacactgttactcctggcacc
aagattgctgtgatatctaagtctgctgctccaagtgagacccatgtttcaccatctgaa
gagacctcccagaaggagacccctccaccaccacctccagagaaacccaaggttgaggaa
aaatcatcaaaagtagaatctgtcaaaccaaaggcgtcaaaactgtcctccccctcagaa
cctcagctccctccaaaggaaagagagagacgggtggcaatgccaagactcaggaagcgt
attgcaaatcgtttaaaggattctcagaacacttttgcaatgttgaccacattcaatgaa
gttgacatgaccaatttgatgaagctgcgttctgattacaaagatgagtttgttgagaag
catggtgtcaaattgggtctaatgtcctgctttgtaaaggctgctgtttctgcacttcaa
aatcagccaattgttaatgctgttattgatggtgatgacatcatatacagagactacatt
gacattagtgtggctgttggcacttccaagggtcttgtggtgcctgttatccgcgataca
gaaggaatgaactttgcggacattgagaaggggataaacaagcttgcaaagaaggcaact
gagggggcactgtcaattgatgagatggcagggggcacctttaccatctcgaatggtggt
gtctatggaagccttatcagcacacccatcatcaaccctccacagtcagcaattcttgga
atgcattccattgttcaacgccctgttgttgtggatggcagcatccttgcaagaccaatg
atgtatcttgcactgacatatgaccataggttgatagatggcagagaagctgttctgttt
ctgcgccgcatcaaggatgtggttgaagatccacggaggatgctccttgacatatag

DBGET integrated database retrieval system