KEGG   Brachypodium distachyon: 100824694Help
Entry
100824694         CDS       T01717                                 

Definition
(RefSeq) probable choline kinase 2
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00564  Glycerophospholipid metabolism
bdi01100  Metabolic pathways
Module
bdi_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100824694
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100824694
    2.7.1.82  ethanolamine kinase
     100824694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Pkinase Haspin_kinase DUF1679 Choline_kin_N
Motif
Other DBs
NCBI-GeneID: 100824694
NCBI-ProteinID: XP_003569688
UniProt: I1HQZ6
Position
2
AA seq 368 aa AA seqDB search
MVAIENQSQAVQAQVQRAAEAARIPKEARRLLHELAAAWPNVADCRALEVVPLKGAMTNE
VYQVRWLTAPAAAAGGEKEKEALKEREIRKVLVRIYGDGVELFFDREDELRTFECMSRHG
QGPRLLGRFPNGRVEEFIHARTLSAADLRDPEISALVATKLREFHNLDMPGPKHVLLWDR
LKNWLKTAKNLCPTDQANELRLDCLEDEIATLEKEFSGDYHHWIGFCHNDLQYGNIMIDE
ETNMLTIIDYEYASFNPVAYDIANHFCEMAADYHSEKPHVLDYSKYPDIDEQRRFVKTYL
STSGEEPEAEEVQNLLQSIDKYTLASHLVWGLWGIISDHVNDIDFDYKEYARQRFEQYWQ
KKPVVLTS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgatcgagaaccagagccaggcggtgcaggcgcaggtgcagcgggcggcggag
gcggctcggatccccaaggaggcgaggcggctcctgcacgagctggcggcggcgtggccg
aacgtggcggactgccgggcgctggaggtggtgccgctcaagggcgccatgaccaacgag
gtgtaccaggtgcgctggctcaccgcccctgcggcggccgcgggcggcgagaaggagaag
gaggcgctcaaggagcgggagatcaggaaggtgctggtgcggatttacggcgacggcgtg
gagctcttcttcgaccgcgaggacgagctgcgcaccttcgagtgcatgtcccgccacggc
cagggaccccgcctcctcggccgtttccccaacggccgcgtcgaggagttcatccacgcc
cggacactgtcagctgccgacctacgcgatcctgaaatttcagctctggtggccacaaaa
ttgagggaatttcacaaccttgatatgcctggtccgaagcatgtgctcctttgggacaga
ctgaagaactggctcaaaactgccaagaacctgtgcccaactgatcaagcgaacgaacta
cgcttggattgcttggaggacgagatcgccacattggagaaagaattttcaggggattac
caccactggatcggtttctgccacaacgatctccagtatggcaacatcatgattgatgaa
gagaccaacatgctgaccatcattgattacgagtatgcaagcttcaacccagttgcatac
gacatcgctaaccatttctgcgagatggcagctgactaccattcagaaaagcctcatgta
ctggactacagtaaatatccagacattgatgagcagaggcgtttcgtgaagacttacctg
agcacttctggcgaggaacctgaagcggaagaggtgcagaatctgcttcagagcattgac
aagtacacactcgccagtcatctggtttggggtctctggggaataatatcggatcatgtc
aacgatatcgacttcgattacaaggagtacgcaaggcagagattcgagcagtactggcag
aagaagcctgtggtcctaacttcatga

DBGET integrated database retrieval system