KEGG   Brachypodium distachyon: 100824818Help
Entry
100824818         CDS       T01717                                 

Definition
NADPH--cytochrome P450 reductase-like
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 683 aa AA seqDB search
MELVAALLRGVTPAELAGGVAAGERAEVRALLATLAAAVLGCALLVLWRRTAAGKKRREA
DKVAAAAPGMQGKAKGGKEEPKDDGRKRVAVFFGTQTGTAEGFAKALAEEAKARYDKATF
KVVDLDDYAAEDEEYEEKIKKEKLALFFVATYGDGEPTDNAARFYKWFTEGNDRGVWLND
LQYGVFGLGNRQYEHFNKVAKVVDELLTEQGGNRLVPVGLGDDDQCIEDDFNAWKEALWP
ELDRLLRDENDVPTGTTYTAAVPEYRVEFVKPEEASRLDRNFSLANGHSVYDAQHPCRAN
VAVCRELHSPASDRSCTHLEFDIAGTGLTYETGDHVGVYTENCPEVVEEAERLLGYSPDT
YFTIHADKEDGKPLDGGSLPPPFPSPITVRNALARYADLLNSPKKSALVALATYASDPAD
ADRLKFLASPAGKDEYAQWVVASQRSLLEVMAEFPSAKPPLGVFFAAVAPRLQPRYYSIS
SSPSMAPTRIHVTSALVHETTPAGRVHKGVCSTWIKNANPAEESWAPVFVRQSNFKLPAD
PSVPIIMIGPGTGLAPFRGFLQERLAQKESGAELGRSVFFFGCRNSKMDFIYEDELNNFL
EQGALSELVLAFSREGSTKEYVQHKMAQKASDIWDVIFQGGMARDVHRVLHTIVQEQGSL
DSSKAESFVKNLQTEGRYLRDVW
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggagctggtggcggcgctgctgcgcggggtgacgccggcggagctggcgggcggcgtg
gcggcgggggagagggccgaggtcagggcgctcctcgccacgctggcggccgccgtgctc
gggtgcgcgctgctcgtgctgtggcggaggacggcggcgggcaagaagcggagggaggcg
gacaaggtggccgccgcggcgcccgggatgcaggggaaggccaagggcggcaaggaggag
cccaaggatgatgggaggaagagggtcgctgtcttcttcggcacgcagaccggcaccgcc
gaggggttcgctaaggcactcgctgaggaggcaaaagcaagatatgacaaagcaactttt
aaagttgtcgacttggatgattatgcggcagaggatgaggaatatgaagagaaaataaag
aaggagaaactagcattgttctttgttgcgacgtatggagatggtgagcccactgacaat
gctgctaggttctacaaatggttcaccgagggaaatgatagaggtgtctggttgaatgac
ctccagtatggtgtgtttggtcttggcaatcgacagtatgagcatttcaataaggttgca
aaagtggttgatgagctcctaaccgagcaaggtggaaaccgccttgttcctgttggtctc
ggagatgatgatcaatgcatcgaggatgacttcaatgcatggaaagaggctctctggcca
gagttagatcggttacttcgggatgaaaatgatgttcccacaggcactacatacacagct
gccgttcctgaataccgggttgaatttgttaagcctgaggaggcatctcgcttggacaga
aactttagtcttgcaaatggtcattctgtgtatgatgctcagcatccttgccgggctaat
gtggcagtgtgtcgggaactccactctcctgcttctgatcgttcatgcactcacttggaa
tttgacattgctggcaccggtcttacgtatgaaactggtgaccatgttggtgtatacaca
gaaaactgccctgaggttgtagaggaggcagagagattgttaggctactccccagacaca
tatttcaccatccatgcagacaaagaggatggtaaaccactagatggtggttctcttcct
cctcctttcccttccccaatcactgtgaggaatgcattggctcgatatgctgatcttctg
aattcaccaaagaagagtgctttggttgcattagctacttatgcttcagatcctgctgac
gctgaccgtctaaagttcttggcatctcctgctgggaaggatgagtatgctcagtgggtt
gttgcgagtcagaggagcctattggaagtcatggcagagttcccttctgcgaagcctcca
ctaggagttttctttgcagcagttgctcctcgtcttcaaccaagatactactcaatttct
tcttcacctagcatggcaccgaccaggatccatgtaacatccgcgcttgtgcatgaaaca
actcctgctggaagagtacataagggagtctgctcaacttggatcaagaacgctaatcca
gcggaagagagttgggctccagtttttgtgaggcaatcaaacttcaaacttcctgctgat
ccatcagtgccaattatcatgattggcccaggaacaggtcttgcacctttccgtggcttc
ttgcaggagaggttggctcaaaaagaatctggagctgagcttggtcggtcagtcttcttc
tttggatgcagaaacagcaaaatggacttcatctatgaagatgagctaaacaacttcctt
gagcaaggagcattgtctgagttggtgctcgccttctctcgtgagggctccactaaggaa
tatgtgcagcacaaaatggcacagaaagcatccgacatctgggacgttatcttccagggt
ggcatggccagagatgtacatagagttctccacaccattgttcaggaacagggatcgctt
gacagttcgaaggctgagagctttgtgaagaacctccagacggaaggtagatatctgagg
gatgtatggtaa

DBGET integrated database retrieval system