KEGG   Brachypodium distachyon: 100825140Help
Entry
100825140         CDS       T01717                                 

Definition
(RefSeq) eukaryotic translation initiation factor NCBP
  KO
K03259  
translation initiation factor 4E
Organism
bdi  Brachypodium distachyon
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100825140
Messenger RNA biogenesis [BR:bdi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100825140
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100825140
Translation factors [BR:bdi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100825140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 232 aa AA seqDB search
MEPAVERKAAEQEDLLRPEHARSEDTPAPAVEEEDEAEAEENERRNRELKAGLHPLRRKL
VLWFTRRTPGTRSQSYEDNIRKIVDFSTVESFWVCYCHLSRPSALPSPTDLHLFKDGIRP
LWEDPANRNGGKWIIRFKKAVSGRFWEDLVLVLVGDQLDYSDDVCGVVLSCRFNEDILSV
WNRNASDHQAVMTLRDSIKRHLKLPHTYLMEYKPHDASLRDNSSYRNTWLRG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggagccggcggtggagaggaaggcggccgagcaggaggatctgctgcggccagagcac
gcccggagcgaggacacgcccgcccctgccgtcgaggaggaggacgaggcggaggcggag
gagaacgaacgccgcaaccgcgagctcaaggccggcctccaccccctcaggcgcaagctc
gtgctctggttcacgcgccggacccctgggacgaggtcgcagtcgtacgaggacaacatc
aggaagatcgtcgattttagcaccgtcgaatcgttctgggtttgctactgccacctctcg
cgcccgtctgccctcccgagccccacggacctgcaccttttcaaagacggtatccgacca
ctctgggaggatcctgcaaatcggaatggtggcaagtggatcatacggttcaagaaggct
gtttctggtcgtttctgggaggatttggtgctggtgctagtgggtgatcaacttgattat
agtgatgatgtttgtggtgtggttctcagttgccgtttcaatgaagacattctaagcgtc
tggaaccgaaatgcatcagaccaccaggcggtgatgacattaagagattcaattaagagg
catctaaagctgccacacacctatttgatggagtacaagccacatgatgcttcactgcga
gacaactcgtcgtacaggaacacatggttgagagggtga

DBGET integrated database retrieval system