KEGG   Brachypodium distachyon: 100825140Help
Entry
100825140         CDS       T01717                                 

Definition
eukaryotic translation initiation factor 4E type 3-like
Orthology
K03259  
translation initiation factor 4E
Organism
bdi  Brachypodium distachyon
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100825140
Translation factors [BR:bdi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100825140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 232 aa AA seqDB search
MEPAVERKAAEQEDLLRPEHARSEDTPAPAVEEEDEAEAEENERRNRELKAGLHPLRRKL
VLWFTRRTPGTRSQSYEDNIRKIVDFSTVESFWVCYCHLSRPSALPSPTDLHLFKDGIRP
LWEDPANRNGGKWIIRFKKAVSGRFWEDLVLVLVGDQLDYSDDVCGVVLSCRFNEDILSV
WNRNASDHQAVMTLRDSIKRHLKLPHTYLMEYKPHDASLRDNSSYRNTWLRG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggagccggcggtggagaggaaggcggccgagcaggaggatctgctgcggccagagcac
gcccggagcgaggacacgcccgcccctgccgtcgaggaggaggacgaggcggaggcggag
gagaacgaacgccgcaaccgcgagctcaaggccggcctccaccccctcaggcgcaagctc
gtgctctggttcacgcgccggacccctgggacgaggtcgcagtcgtacgaggacaacatc
aggaagatcgtcgattttagcaccgtcgaatcgttctgggtttgctactgccacctctcg
cgcccgtctgccctcccgagccccacggacctgcaccttttcaaagacggtatccgacca
ctctgggaggatcctgcaaatcggaatggtggcaagtggatcatacggttcaagaaggct
gtttctggtcgtttctgggaggatttggtgctggtgctagtgggtgatcaacttgattat
agtgatgatgtttgtggtgtggttctcagttgccgtttcaatgaagacattctaagcgtc
tggaaccgaaatgcatcagaccaccaggcggtgatgacattaagagattcaattaagagg
catctaaagctgccacacacctatttgatggagtacaagccacatgatgcttcactgcga
gacaactcgtcgtacaggaacacatggttgagagggtga

DBGET integrated database retrieval system