KEGG   Brachypodium distachyon: 100825286Help
Entry
100825286         CDS       T01717                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase-like protein 5-like
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
bdi  Brachypodium distachyon
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bdi01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bdi00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:bdi00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:bdi00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 384 aa AA seqDB search
MAQEQANPEEVVLGQEINGARVVTLNRPRQLNGISDRVVYILAQFLEKWEKDDDAKLVIF
KGAGRAFSAGGDLKMFYEGRSDDSCLEVVYRMYWLCYHIHTYKKTTVALVNGLAMGGGAA
MVAPLKFAVVTEKTVFATPEASVGLHTDCSFSYIHSRLPGYLGEYLALTGARLTAKEMVA
AGLATHFVLSEKLEELEKQLLNLNTGDESAVRAVIEEFSMDVQPDHESILNKLPTINKCF
SAESVEEILKALESEVSIDGNQWIAPVLKSMRRSSPTATKVTLRSVREGRKQSLSECLKK
EFRLTMNILRSVVTGDVYEGIRALSIDKDNAPKWSPTTIEEVKNEDIDCVFQPFSSEHEL
QVPSDDFKRWSGKYEHTIYADSSN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagaacaagcgaatcccgaggaggtcgtcctcgggcaggagatcaacggcgcg
agggtggtcaccctcaaccgcccgcgccagctgaatggcatctccgacagagtggtctat
atcctagcccagttcctggagaagtgggagaaagatgatgatgccaagttggtcatcttc
aagggagctggacgggcattttctgctggtggggacctaaagatgttctatgaagggaga
tcagatgattcatgcctcgaggttgtgtataggatgtactggctctgctatcacattcat
acatacaagaaaaccacggtggctcttgttaatggacttgccatgggtggaggtgcagcc
atggttgctccactgaagtttgcagttgtcacagagaaaacagtttttgccactcccgag
gcaagtgttggattacacacagattgtagcttttcttatatccactctcgactccctgga
tatttaggggagtacctggctttgactggtgctaggctgactgcaaaggaaatggttgct
gctggtcttgctactcattttgttctttctgaaaaactggaggaactcgaaaagcaatta
ctgaatttaaacacaggtgacgagtctgcagtccgagctgtcatcgaagagttctctatg
gatgttcaacctgatcatgagagcattttgaacaagcttccaactatcaacaaatgtttc
tcagctgagagtgttgaggaaatcttgaaagcacttgaatcagaagtgagcatcgatgga
aaccaatggatagctccagtcctaaagagtatgaggagatcatctcctactgcaacgaag
gtcacactgcgatcggttagagaaggtcggaagcagagtctgtccgaatgtttgaaaaag
gaattcagactaaccatgaacatcctccgttctgtggttactggcgatgtttatgagggt
attagagctctgagtatcgacaaagataacgcccctaagtggagccctactaccattgaa
gaggtgaagaacgaagacattgactgtgttttccaaccattcagctcagagcatgagctc
caagtcccatctgatgatttcaagaggtggagtggcaaatacgagcacacaatctatgcc
gattcttccaactga

DBGET integrated database retrieval system