KEGG   Brachypodium distachyon: 100825943Help
Entry
100825943         CDS       T01717                                 

Definition
formamidopyrimidine-DNA glycosylase-like
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bdi  Brachypodium distachyon
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bdi03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 448 aa AA seqDB search
MPELPEVEAARLALEEHCVGKRIVRCSAADDTKVIDGIAPSQLEAALVGRTIAAARRKGK
NLWLVLDSPPFPSFQFGMAGAIYIKGVELSKYKRSAVSPTEEWPSKYSKLFVELDDGLEF
SFTDKRRFAKIRLLDNPEAIPPISELGPDALFDPMQLDDFVQSLGRKNVPIKSLLLDQSI
MSGIGNWIADEVLYLARIHPMQTASKISKEKYKALHRCIKEVIEKSVEVGADSSEFPQDW
IFHSREKKPGKAFVDGKKIDFITVGGRTSAYVPELQMLDGADAVAENRCKRRKEKLEKKD
DTTLKKGPRAPKENKKTAKAMTVDDEEEDNPVKQRAKAAKPTKRGRKPMQVAKASSNKAV
SSSTHDNEADEEDQDDEEASKPAKRGRKQPATGSSNKDDCSPDTGNDGKVEAKPGKRRGQ
KQPAAEVKSLPDNEETAVPAKRPQRKKR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctgccggaggtggaggcggcgcgactggcgctggaggagcactgcgttggg
aagaggatcgtgcggtgttccgccgcggatgacaccaaggtcatcgacggcatcgctccg
tcgcagctggaggcggcgctggtcgggaggaccatcgccgccgcacggcgcaagggcaag
aacctatggctcgtgctggactcgccgcctttcccttccttccagttcggaatggcagga
gctatttacatcaagggtgtggagctgagtaaatataaaaggtctgcagtgagcccaact
gaggaatggccttcaaagtactccaaactgtttgttgaattagatgatggcttggagttt
tccttcacagataagaggcgttttgcaaaaatacgattgcttgacaatccagaagccatc
cctccaatttcggagctaggaccagatgccttatttgatccaatgcagcttgatgatttt
gtgcaatctttaggtagaaagaatgtgccaataaaatcccttttgcttgatcagagcatt
atgtcaggaattggcaactggattgcagatgaggtgctttatctggcgaggatccatcct
atgcaaactgcatcgaagatatcgaaggagaaatacaaggcactccatcggtgtattaaa
gaggtgattgaaaagtctgttgaagttggtgctgatagcagtgaatttccacaagactgg
atatttcattctagggagaagaaacccggcaaggcctttgtggatgggaagaaaattgac
ttcattacagtaggtggtaggacttcggcgtatgttccggagctgcagatgttggatggg
gctgatgcagtcgcagaaaacagatgtaagagaaggaaagagaaactagagaaaaaagat
gatacaactttgaagaaaggcccaagggctccaaaagaaaataaaaagactgcgaaggca
atgactgttgatgacgaggaggaagataatccagtaaagcaaagggcaaaagcagcaaaa
cccaccaagaggggaaggaagccaatgcaagtagcaaaagcatcatctaataaggctgta
agtagtagtactcacgacaatgaagccgacgaggaggatcaagatgacgaggaagcttcg
aaaccagcaaagaggggaaggaagcaaccagcgacgggctcatcaaacaaagatgattgt
tctccagatactggtaacgatggcaaggtagaggcaaagccagggaagaggaggggtcag
aagcagccagcagcggaggtaaagagcttgccagacaatgaagagactgccgtcccagca
aagaggccacaaaggaagaagcggtaa

DBGET integrated database retrieval system