KEGG   Brachypodium distachyon: 100826085Help
Entry
100826085         CDS       T01717                                 

Definition
histone deacetylase 5-like
Orthology
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100826085
Protein phosphatases and associated proteins [BR:bdi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100826085
Messenger RNA biogenesis [BR:bdi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100826085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 709 aa AA seqDB search
MAAASAAPAAAGAAHPVGAAPRVGLLYDERMCAHATPDGKYHPENPERLRAIWKKLGEQG
VAERCVIMPAKEAKDKYIASVHSSTHVKLMKSISSKEHNYRRKNLASNYNSIYFNEGSSE
SAFLAAGSVIEVAEKVAAGELSSAIALVRPPGHHAEHNEPMGFCLFNNVAIAANYLLNER
PDLGIKKILIVDWDVHHGNGTQKMFYNDSRVLFFSVHRFDHGAFYPSQGDASHCFIGEGD
GQGYNINVPWNHGGCGDADYIAAWDHVLLPVAEAFDPDIILLSAGFDAARGDPLGGCDVT
PDGYARLLTKLLGFAKGRMVMALEGGYNTVSIANSVLFCAKVLLGDQFRLKPPKDSPFDS
TWNVIKEVRDELKTCWPVLRSKLPKNVPLRSSSSYVELYSSSGSECDVEDDNERPDANSS
VSIIQVDDDVVSERIAMLTLDEDNLATKTTSSCTTDERRATDSVQAQNDGFVVASTGIYG
QSLTWRSALSRVYVWYASFGSNMWKPRFMCYIQGGKVDGMSIACFGSHDTSPPRGAMWKT
VPHRLFFGRSSTPCWGAGGVAFLNPETNYNEKSWICMYKITLEQFNDVLFQENRLVKDDN
EGGKAESPDSPLIGLSEIESLSSNKALHLEPIKDSWYSNVLYLGQEDSIPILTMTCPSLD
VVRHKAGELPLSPPSDTYSATLIRGLVEGKQLDANEAASYIDAAAARGL
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagcgtcggcggcgccggcggcggcgggcgcggcgcatccggtgggtgcagcg
ccccgggtggggctgctgtacgacgagaggatgtgcgcgcacgcgacgccggacgggaag
taccacccggagaaccccgagcggctgcgggccatctggaagaagctcggcgaacagggt
gtcgcggaaaggtgtgtgatcatgccggcgaaggaagccaaggacaaatatatagcttca
gtccatagctcgacccatgtaaaactgatgaagagtattagctcgaaggaacacaattat
cgtcgaaaaaatcttgctagcaactataattccatttacttcaacgagggctcctcagag
tctgcttttcttgcagctggttctgtcattgaggtcgctgagaaggttgcagctggtgag
ttgagttctgctatcgctctcgtcagacctcctggccaccatgccgaacataatgagcca
atggggttttgtctcttcaacaatgtggccattgcagctaattatctcttaaacgagagg
cctgatttaggtatcaagaagatattaatcgtcgattgggatgttcatcatggaaatggt
acacagaaaatgttctataatgactctcgtgtattgttcttttcagttcacagatttgat
catggagctttctaccctagtcaaggggatgcatctcactgtttcattggagaaggagat
ggtcaggggtacaacattaatgtgccctggaatcatggaggatgcggcgatgcagattat
attgctgcatgggaccatgtgctgcttcccgtcgcagaagcatttgatcctgatataata
ttactgtctgctgggtttgatgcagcgaggggtgatcctcttggtggttgcgatgtcacg
ccagatggatatgcacgcctactaacaaagctgttaggttttgcaaaaggaaggatggtg
atggctcttgaagggggttataacacagtgtccatagcaaattcagttttattttgcgca
aaagttttgttgggagaccagttcagacttaaacctccaaaggattcacctttcgattct
acatggaacgttattaaagaggtacgtgatgaattaaagacgtgttggcctgttttacgc
agtaagcttccgaagaatgtacccttgaggagttcatcctcatacgtcgagctgtactct
tcctctggttccgagtgtgatgttgaagatgataatgagcgtcctgatgccaattcatct
gtcagtattattcaagttgatgatgatgttgtaagtgagcgcatcgcaatgttgacactt
gatgaagataaccttgcaacgaagaccacatcaagttgcacaacagacgaacgaagggca
actgattcagttcaagcacaaaatgatggatttgtcgtggcgtctacaggaatatatggc
caatctcttacttggagatcagcattgtcaagagtttatgtttggtatgccagctttggt
tcaaacatgtggaaaccaaggttcatgtgctacattcaaggggggaaggttgatggtatg
agtatagcatgttttggttcacatgacacaagcccaccaagaggtgccatgtggaagact
gtgcctcataggttgttttttgggagatcctctaccccttgctggggtgctggtggcgtt
gctttcctcaaccctgagacaaactacaacgagaagtcatggatctgcatgtacaaaata
acgctcgagcagtttaatgatgtattgtttcaagagaaccgtttagttaaggatgacaat
gaaggtggaaaagctgagtctcctgactctcctcttattggcttgtccgaaatagagtct
ctctcttcaaacaaagctcttcatcttgaacctattaaggatagctggtactccaatgta
ctttatcttggacaggaggattccattccgattctaactatgacatgcccctcattagat
gttgtgaggcacaaagccggtgagctgccattgtctcctccatcggacacctactccgcc
actctcatcaggggactcgtggaagggaagcagctggacgccaatgaagctgcaagttac
atcgatgctgctgctgcaagaggcctgtga

DBGET integrated database retrieval system