KEGG   Brachypodium distachyon: 100826178Help
Entry
100826178         CDS       T01717                                 

Gene name
MKK6.1
Definition
mitogen-activated protein kinase kinase 1-like
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
bdi  Brachypodium distachyon
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    100826178 (MKK6.1)
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100826178 (MKK6.1)
Protein kinases [BR:bdi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100826178 (MKK6.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 356 aa AA seqDB search
MRGKKPLKELKLSVPAQETSVDKFLTASGTFKDGELRLNQRGLRLISEEENGDEHQSTNM
KVEDVQLSMDDLEMIQVIGKGSGGVVQLVQHKWVGTFYALKGIQMNIQEAVRKQIVQELK
INQATQSPHIVSCHQSFYHNGVIYLVLEYMDRGSLADIIKQVKTILEPYLAVLCKQVLEG
LLYLHHERHVIHRDIKPSNLLVNHKGEVKITDFGVSAVLASSIGQRDTFVGTYNYMAPER
ISGSSYDYKSDVWSLGLVILECAIGRFPYTPSEGEGWLSFYELLEAIVDQPPPGAPADQF
SPEFCSFISACIQKDPAERMSASELLNHAFIKKFEGKDLDLRILVESLEPPMNVPE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagggggaagaaaccgctcaaggagctcaagctctctgtgccggcgcaggaaacatcc
gtcgataaatttctgacggcgagtggcacattcaaggatggagaactgcgacttaatcaa
agaggtttgcggctgatctccgaggaggaaaacggagatgaacatcaatcaacaaacatg
aaggtggaagatgtgcagttgtcaatggatgacctcgagatgattcaagtcattggtaag
ggaagtggtggcgtcgtccaactcgtgcagcacaagtgggtgggcacattttatgcgttg
aagggcattcaaatgaacattcaggaggcagttcgcaaacaaatagtacaggagctcaaa
ataaatcaagcaacacagagcccacatatagtttcttgccatcaatcgttttaccacaat
ggtgtaatatatcttgttctagaatacatggatcgtggatctcttgcagacataattaaa
caagttaaaaccattctggagccatacctcgcagtactttgcaagcaggttttggagggt
cttctatatctgcatcatgaaaggcatgtgattcacagggacataaagccatctaacttg
ttagtcaatcataaaggtgaagtaaagattactgattttggggtaagtgcagtgctagca
agttcgattggccagcgtgatacatttgttggaacctacaactacatggcgcctgagcgg
ataagtggcagctcctatgactacaagagtgacgtatggagtttgggcttagtaatactt
gaatgtgccattggccgcttcccctatactccttcagaaggagaaggttggctaagcttc
tatgaactattagaagcaattgttgaccagccaccacctggtgcacctgcagatcagttc
tctccagaattctgctcatttatctctgcctgcatacaaaaggaccccgcggaacgcatg
tctgcttcagaactcttgaaccatgctttcattaagaagttcgagggcaaggatctagac
ctacgaattcttgtcgagagccttgaaccacctatgaatgtacctgaataa

DBGET integrated database retrieval system