KEGG   Brachypodium distachyon: 100826287Help
Entry
100826287         CDS       T01717                                 

Definition
histone-lysine N-methyltransferase ASHH3-like
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
bdi  Brachypodium distachyon
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100826287
Enzymes [BR:bdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100826287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 338 aa AA seqDB search
MKPEDVFNKLTKKLQDPADFVDFDLPSALKEWKLGYYIPIKRNVYLMKKRVEDDGIFCAC
PFISGSSVACGKDCQCGMLFSCCSSNCKCENRCANKSFQLRPMKKTKLIKTEKCGFGLVA
DEGIQQGEFIIEYVGEVIDDRTCEERLWKMKRQRYTNFYLCEVSSNMVIDATNKGNKSRF
INHSCQPNTEMQKWTVDGETRVGIFALHDIKKGEELTYDYKFVQFGADQDCHCGSSNCRK
MVGTSKSVNSIVLHNGNSGSSQDQHIVKKRKTTSDNCIGEIIRLWDRRDKMYVPAVIYDF
DEYTAMHTLLFDEEATEKFDLGEEDWNFLPRPEDPDED
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgaggatgtgttcaataaattgaccaagaaactgcaagatcctgccgatttt
gtggattttgacctgccatctgcattgaaagaatggaagttaggctactacataccaatt
aagcggaatgtttatcttatgaagaaacgcgttgaagatgatggcattttctgtgcttgt
ccttttatttctggatcatcagttgcttgtggaaaagattgccaatgcgggatgctgttc
tcttgttgttcatcaaactgtaaatgtgagaataggtgtgccaataaatcattccagctc
aggcctatgaaaaaaaccaaattgattaagacagagaaatgtgggtttggattggtagct
gatgaaggaatacagcaaggagagtttattatagaatatgtaggtgaagttattgatgac
aggacttgtgaggaaagactatggaaaatgaagagacagcgctacactaacttttacctt
tgtgaggtcagtagcaacatggtcattgatgcaacaaacaagggaaacaagtcaaggttt
atcaatcatagttgtcaaccaaacacagagatgcagaaatggactgtagatggagagacc
agagtaggaatttttgctcttcatgacataaagaaaggagaggagctaacctatgactat
aaatttgtccagtttggagcagatcaagattgccattgtggatcttcaaactgcagaaaa
atggttggcacctctaagtcggtcaactcaattgttcttcacaatggcaactcaggcagc
tcacaagatcagcatattgtgaaaaaaagaaagacaacctctgataattgtattggggag
attatccgtttgtgggatcgacgggacaaaatgtatgtcccagcagttatatatgacttc
gatgagtacactgcaatgcatactttactgtttgacgaagaagctactgaaaaatttgat
ttgggagaggaagattggaacttcctaccgcgtccagaagatccagatgaagactga

DBGET integrated database retrieval system