KEGG   Brachypodium distachyon: 100826316Help
Entry
100826316         CDS       T01717                                 

Definition
NAD-dependent deacetylase sirtuin-6-like
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100826316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 465 aa AA seqDB search
MSLGYAKKLSYREDVGSVGMPEMFDSPELLQKKIEELAVMIRKSKHLVVFTGAGISTSSG
IPDFRGPKGVWTLQRSGKGVPDASLPFHRAVPTLTHMALVELERAGVLKFVISQNVDSLH
LRSGLPREKLAELHGNSFMEICPCCKAEYLRDFEIETIGLKDTPRRCSDKNCGTRLKDTV
LDWEDALPPEEMNSAKEQCLAADLVLCLGTSLQITPACNMPLMSIKNGGKVAIVNLQATP
KDKKASLVIHGLVDKVIAGVMCILNLRIPPYVRIDFIQLSLRHTVKKKCVRWTLRVTSIH
GLRAPLSFLRSIEVSFPERPDMKPVVLMEQPFSLQRETSMARAFFMLLTLNFSDGCGCSS
SSIECHVDFQKQKENFFRDRSLVLQELKCAAERQCRAGQQSILERQSLARAETSMHAFVT
NMVSYDAEDLKVAKPRGTWMDSSSNLTKRHLEVPTGGSPPPKKLK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgggctatgctaagaagctgtcgtaccgggaggatgtgggcagtgtgggcatg
cctgagatgtttgattcccccgaactcctccagaagaagatagaagagcttgcggttatg
atccgaaagagtaagcatttagtggtgtttaccggagcagggatatcaacttcatcaggc
atacctgatttccgagggccaaagggtgtgtggactctgcagcgttcaggaaaaggtgtt
cctgatgcttcactaccatttcaccgagcagttccaaccttgacccatatggcactagtt
gaattggaaagagcaggagtcctaaagtttgtcataagccagaatgttgacagcctacat
ctgcgttctggactcccaagggagaagctggccgaattgcatgggaattctttcatggaa
atctgcccatgctgtaaagcggagtaccttcgggattttgaaatcgagacaataggactg
aaggatactccgaggcgttgttctgataagaactgtggaactagattaaaagatacagtt
cttgattgggaggatgctttaccacctgaggagatgaattctgccaaggagcaatgtcta
gcagctgaccttgtcctatgtcttggaactagcttgcagattactcctgcatgtaatatg
cctcttatgtcaatcaagaatggggggaaagtggctattgttaatcttcaggcaactcca
aaggataaaaaggcaagccttgtcatccatggacttgtggacaaggtcattgctggagtc
atgtgcattctgaatctgcgcatcccgccatatgtgcgtatcgacttcattcagcttagt
cttcgacacacagtcaaaaagaaatgtgtaagatggactctgcgagtaacaagcattcat
ggtctgagagcaccattatcatttcttcgttcaattgaggtttcctttcccgaaagacct
gacatgaagcctgtagtgcttatggagcaaccattttctttgcagagggaaacatcaatg
gctagagcattcttcatgttgttgacattgaacttcagtgatggttgtggctgctcaagc
tcgtcaattgaatgtcatgttgattttcagaagcaaaaggagaacttttttcgagataga
agcctagtgctgcaggagctgaagtgcgccgcagagcgccagtgccgtgccggtcagcaa
tctattcttgaaaggcaaagtctggcaagagctgagacatctatgcatgcatttgtgacc
aacatggtcagttacgacgctgaagatctcaaggtggccaagcccaggggtacctggatg
gacagcagcagcaaccttacaaaacggcacctggaagtccctactggcggctcgccgcca
ccaaagaagctaaagtga

DBGET integrated database retrieval system