KEGG   Brachypodium distachyon: 100826370Help
Entry
100826370         CDS       T01717                                 

Definition
magnesium-chelatase subunit chlI, chloroplastic-like
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bdi00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 417 aa AA seqDB search
MAPPPLFSPASAPAASPALFSASTSRPLFVTAASAVSARTPSSRRRWGSRRRLTVRNVAA
PEASTATKAAGGAKESQRPVYPFPAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKST
TVRSLVDLLPDISVVVGDPFNSDPYDPEVMGPEVRDRVLKGDSLPVTTAKITMVDLPLGA
TEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWN
TVEREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERAR
FDRDPKSFRQSYLEEQEKLQEQITSARGNLGSVQLDHDLRVKISKVCAELNVDGLRGDIV
TNRAAKALAALKGRDTVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcctcccctcttctcgccggcgtcggcgcccgccgcctcgccggccctcttc
tcggcctccacctcccgccctctcttcgtcaccgccgcctccgccgtctcagcccggact
ccgtcttcaaggaggaggtggggatcccgccgccgcctcaccgtgcgcaatgtcgcggcc
cccgaggcctcgaccgccaccaaggcggcggggggcgccaaggagagccagcggccggtg
tacccgttcccggccatcgtggggcaggacgagatgaagctctgcctcctgctcaacgtc
atcgaccccaagatcggcggcgtcatgatcatgggcgaccgcggcaccggcaagtccacc
accgtccgctccctcgtcgacctgctcccggacatcagcgtcgtcgtcggcgacccgttc
aactccgacccttacgacccggaggtcatggggcccgaggtccgcgaccgcgtgctcaag
ggcgacagcctccccgtcaccaccgccaagatcaccatggtcgacctgcccctcggcgcc
accgaggacagggtctgcggcaccatcgacatcgagaaggccctcaccgagggtgtcaag
gcgtttgagcctggattgcttgccaaggccaatagagggatactgtatgtcgatgaggtc
aatctgctcgatgatcatctggtggatgtgctgctggattccgccgcttccgggtggaac
accgtcgagagggagggtatctctatctcccatccggcgcgtttcatcctcattgggtcc
ggtaacccggaggaaggtgagctccgtccgcagctgctcgaccggtttgggatgcatgcg
caggttggtacggtcagggatgccgagctcagggtgaagattgtggaagagagggctcgg
ttcgacagggacccaaagtcgttccgtcagtcctacttggaggagcaagagaagctccag
gagcagatcacatctgctcggggtaaccttggttctgtgcagcttgaccatgatcttcgc
gttaagatatccaaggtgtgtgccgagttgaatgtggatggattgagaggagacattgtg
actaacagggctgccaaggccttggctgccttgaaaggaagggacactgtcacagtggag
gacatcgcaactgttattcccaactgcttgaggcatcggctccgtaaagacccgcttgaa
tcaatcgactcaggtttgcttgtcattgagaagttctatgaagtctttagctag

DBGET integrated database retrieval system