KEGG   Brachypodium distachyon: 100826413Help
Entry
100826413         CDS       T01717                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 3-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
bdi  Brachypodium distachyon
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100826413
   00500 Starch and sucrose metabolism
    100826413
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     100826413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
5
AA seq 587 aa AA seqDB search
MGTAAALPLLVCLLCWTAVIVRSSHIVYPELQSLEAKEVDKELRTGYHFQPPKHWINDPN
GPMYYKGLYHLFYQYNPKGAVWGNIVWAHSVSTDLIDWVGLEPGIYPSKPFDVNGCWSGS
ATVLPSGVPVIMYTGIDPDERQVQNVAYPANLSDPFLREWVKPNYNPIINPDQGINASAF
RDPTTAWFGPDGHWRLVVGSKENMRGIAVLYRSRDFKKWIKAHHSLHAGLTGMWECPDFY
PVAVAGMGSRSHRNGMDTAELHDAAVAKEVKYVLKVSLDLTRYEYYTVGTYDHAKDRYTP
DPNFPDNDYGLRYDYGDFYASKSFFDPAKKRRVLWGWANESDTVPDDRHKGWAGIQAIPR
KIFLSRSGRQLIQWPVEEVKSLRAKHVNVSNKAVKSGDYFEVTGFKSVQSDVEAAFAIKD
LDKAETFDPAWRTNAQGLCHKLNSHVKGGVGPFGLWLLASGDLKERTAVFFRVFKTNDTA
EHVVLMCNDPTRSSYESQIYRPTFAGFVNVDIAKNKRIALRTLIDHSVVESFGAGGKTCI
LTRVYPRKAIGDDAHLFVFNNGESDIKVTNLRAWEMKTPKMNAPEKI
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggggacggcggcggcgctgccgctgctagtgtgtctgctgtgctggacggcggtgata
gtgcgctcgtcgcacatcgtctacccggagctccagtcgctggaggcgaaggaggtcgac
aaggagctacgcaccgggtaccacttccagcctcccaagcattggatcaatgatccgaat
gggccgatgtactacaaggggctttaccacctgttctaccaatacaaccccaagggcgcg
gtgtggggcaacatcgtgtgggcgcactctgtttcgacggatctgatcgactgggtaggg
ctggagcccgggatctacccttccaagccgttcgacgtcaatggctgctggtcgggctcc
gccacggtgctccccagcggcgtgcccgtcatcatgtacacgggcatcgaccccgacgag
cgccaggtccagaacgtggcgtacccggccaacctctccgaccctttcctccgcgagtgg
gtcaagcccaactacaaccccatcatcaacccggaccagggcatcaacgccagcgccttc
cgcgatcccacaacagcctggtttggcccggacggacattggaggctggtggtgggcagc
aaggagaacatgagggggatcgcggtgctgtaccggagcagggatttcaagaagtggatc
aaggcgcaccactcgctgcatgcgggcctgacgggaatgtgggagtgtccagatttttat
cccgtggccgtggccggaatgggaagccggagccacaggaacggcatggacaccgccgag
ctgcatgacgccgccgttgccaaggaggtaaaatacgtgctgaaggtgagcctggacctg
acgaggtacgagtactacacggtgggcacgtacgaccacgccaaggaccggtacaccccg
gacccgaacttcccggacaacgactatggcctccgctacgactacggcgatttctacgcc
tccaagtccttcttcgacccggccaagaagcgccgcgtgctctggggatgggccaacgag
tctgacactgtccccgacgaccgccacaagggctgggccggcattcaggcgataccgagg
aagatcttcttgtcacggagcgggaggcagctgatccagtggccggtggaggaggtcaag
tcactgcgcgcgaagcacgtcaatgtgagcaacaaggctgtcaagagcggcgactacttc
gaggtcaccggcttcaagtccgtgcagtcggacgtggaggcggcgttcgcaatcaaggac
ctggacaaagcggagacgttcgacccggcttggcggaccaacgcgcaggggctgtgccac
aagctcaactcgcacgtcaagggcggcgtggggccgttcgggctgtggctgctggcctcc
ggcgacctcaaggagaggacggccgtcttcttcagagtgttcaagaccaacgacacggcc
gagcacgtcgtgctcatgtgcaatgaccctaccaggtcgtcttacgagtcgcagatctac
aggccaaccttcgccggcttcgtcaacgttgacatagctaagaacaagaggatcgccctg
aggaccctgatcgaccactctgtggtggagagcttcggggccggcggcaagacgtgcatc
ctgacgagggtctacccgaggaaggctatcggcgacgacgcgcacctcttcgtgttcaac
aacggcgagtcggacatcaaggtcaccaacctgcgcgcatgggagatgaaaacccccaag
atgaacgcgccggagaagatttag

DBGET integrated database retrieval system