KEGG   Brachypodium distachyon: 100826613Help
Entry
100826613         CDS       T01717                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 569 aa AA seqDB search
MAAAVAAAAADQPRRRKPTPGRGGVVLPAGLSEEEARVRAIAEIVSEMGELSRRGEDVDL
NALKSAACRRYGLARAPKLVEMIAAVPEADRAALLPRLRAKPVRTASGIAVVAVMSKPHR
CPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRL
GHSVDKVEFILMGGTFMSLPAEYRDYFIRNLHDALSGHTSANVEEAVCYSEHSAVKCIGM
TIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFSLAKDAG
FKVVAHMMPDLPNVGVERDMESFKEFFENPAFRADGLKIYPTLVIRGTGLYELWKTGRYR
NYPPELLVDIVARILSMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMEDLGLKC
RDVRTREAGIQDIHHKIRPDEVELVRRDYAANEGWETFLSYEDTRQDILIGLLRLRKCGR
NVTCPELIGRCSIVRELHVYGTAVPVHGRDAEKLQHQGYGTLLMEEAERIACKEHRSKKL
AVISGVGTRHYYRKLGYELEGPYMVKCLS
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccgtagccgcagccgcggccgaccagccgcgccgccgcaagccgacgccg
ggccgcgggggcgtggtcctccccgcggggctttccgaggaggaggcgagggtgcgggcc
atcgcggagatcgtgtcggagatgggcgagctctcgcgccgaggggaggacgtggacctg
aacgcgctcaagtcggccgcgtgccggcggtacgggcttgcacgcgcgccgaagctggtg
gagatgatcgcagcagtgccggaggccgaccgcgcggcgctgctcccccgtctgcgcgcc
aagcccgtgcgcacggcgtcgggcatcgcggtggtcgccgtgatgtcgaaaccgcaccgg
tgcccccacatcgcgaccacggggaacatctgcgtctactgccctggaggccccgactcg
gacttcgagtacagcacccagtcctacactggatacgagcccacaagcatgcgcgccatt
cgggcaaggtacaatccatatgtgcaggccagaagcaggatagatcagctcaaaaggcta
ggacatagtgtggacaaggtcgagttcatcttgatgggtgggactttcatgtcattacca
gctgagtatcgtgattatttcatcagaaatcttcatgatgctttatcagggcatacttct
gctaatgttgaggaggcggtttgttattcggaacatagtgctgtcaaatgcattggtatg
acaattgagacgagacctgattattgcttggggcctcatttgcggcagatgctatcttat
ggctgtacccgcttagaaattggtgttcagagtacatatgaggatgtcgcacgtgacaca
aacagaggtcacacagtagctgctgttgctgattgcttttctttagcgaaagatgcgggc
tttaaggtggttgcacacatgatgccagatttacctaatgttggagttgaaagagatatg
gaaagtttcaaggaattttttgaaaatccagcattccgagcagatggtctaaagatctac
ccaactcttgtgattcgtggaactggtctttatgagctctggaaaactggaaggtataga
aactatccacctgagctattagtggatattgtagctagaattctgtcgatggtaccgcca
tggacacgggtctatcgtgtccagagagatatccctatgcctcttgttacctctggtgtc
gagaaaggtaacctgcgtgagcttgctttggctcgaatggaagatttgggcttgaaatgc
cgagatgtcagaacccgtgaggcaggaattcaggacatccatcacaagatcaggcctgat
gaagtggagcttgtcaggcgtgattatgctgcaaatgagggctgggagaccttcctctca
tatgaggatacacggcaggatatcctaattggcctgttgcgcttgcgtaaatgtggccgc
aatgttacatgccctgaactcatagggaggtgttcgattgtccgtgaacttcatgtctac
gggacggcagttcctgtgcacggtcgtgatgcagagaaactacaacaccaggggtatggg
actctcctgatggaagaagcagaaagaatcgcttgcaaggagcaccggtcaaagaagttg
gctgttatctcaggagttggaacccgccactactatcgcaagctgggttatgaacttgag
gggccttacatggtcaaatgtctgtcataa

DBGET integrated database retrieval system