KEGG   Brachypodium distachyon: 100826635Help
Entry
100826635         CDS       T01717                                 

Definition
uncharacterized LOC100826635
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 895 aa AA seqDB search
METLNPDAADGAAAAAAAAARSELEVKRPEKAEAAALDPELTVARIYLGRIGAGLQNLGN
TCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHVKTALQSTGKIVTPSQ
IVKNLRCISRSFRNSRQEDAHELMVNLLESMHKCCLPSGVPSESPSAYEKSLVHRIFGGR
LRSQVKCTRCSHCSNKFDPFLDLSLDIAKASNLVRALQNFTEDELLDGGQKQYQCERCRQ
KVVAKKRFTIDRAPNVLTIHLKRFSPFNPRDKIDKKVDFQPVLDLKPFVSDSKVSDYKYS
LYGVLVHAGWNTQCGHYYCFVRTSSGMWHNLDDNQVRQVREADVLKQKAYMLFYVRDRVV
DTVARKDPPNVPVKKMNPGKISCLNGGIQSGAIEAKLSGLSSPSVDKKLQSISIGHSGVG
SMTSVDRCSNNDGKTENPAASQNTMLSTAQKGPLSQNDDATLSTKSKQVALSDHKETSSP
CQSASLISASGNQTMAKMSLQEPMTGGAFTKLGNNTSVASPIVSSPPGLFGAEKQTFCSQ
PTIYAKQTFNVNNTDTGFTAQNLPTKDGIVSNGVIPSISSGGPTCSEKVNDLTESLKRDD
SAVKELSMSKNTIVPGLEQVDVEKQADSCNGRMARRVDTKPTKLVRYPVVNFWLGPRSLL
LGSLKLQKKKKHKRTKRRHAVYKDVEIADCSGANTNEQQASTSATVSSETAQCTPRKRKH
SYASVSSENDTEALKKRQQVVGASDAGDHNIDIRKRNSASSGGAEPPKMGSSSYANQAHP
RNNIDASTGATSQHVAIHLKDLSGEVTVPCWDDVGVRNTETGECKSSGRRSIGYVLDEWD
EEYDRGKTKKVRKAKEDNYDGMNPFQEEANSVSDRKTRRKAFQARLLNKPARSHH
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccctgaatccggatgccgcggatggggcggcagcggcggcggcggcggcggcg
aggagtgagctcgaggtcaagaggccggagaaggcggaggcagctgcgttggatccggag
ctcaccgtggccaggatctaccttgggagaattggtgctggtctgcaaaatcttgggaac
acttgctacctcaactcggttctgcaatgcttgacatacacggagccgtttgcagcatac
ctgcagagtggacggcacaagtcttcatgtcgtactgctggattttgtgcattatgtgct
cttcagaaccacgtcaagactgctctacaatcaactggaaaaatagtgacaccatcacaa
attgtgaagaacttgcgctgcatttctcgtagtttccgcaattcgaggcaggaagatgca
catgagttaatggttaacttgcttgaatccatgcataaatgctgtttgccttctggagta
ccaagcgagtctccgagtgcttatgagaagagcttagttcacagaatatttggtggccgc
ctaagaagtcaggtgaaatgcacaaggtgttctcattgttccaacaaatttgatcctttc
ttggatctcagtcttgatattgccaaggcctcaaatttggtgagagcacttcaaaatttc
actgaggatgaactactcgatgggggtcaaaagcagtatcaatgtgagcgctgcaggcag
aaagttgtagcaaagaaaaggtttacaattgatagagctccaaatgttttgacaattcat
ctgaagcgctttagccctttcaatcctcgtgacaagattgacaaaaaagtggattttcaa
ccggttctagacttgaaaccatttgttagtgattctaaagtatcagattacaaatacagc
ctttatggtgttttggttcatgctggttggaatactcaatgtggtcattattattgcttt
gttcggacttctagtgggatgtggcacaatcttgacgataatcaggtacgccaagttcgt
gaggcagacgtattgaaacagaaagcctatatgttattttatgtacgcgacagagttgtt
gacacggtggcgcgtaaagaccctcctaatgtgcctgtaaagaaaatgaaccctgggaag
atctcatgtcttaatggtggaatccaaagtggtgcaatagaagcaaaattgagtggtctg
tcatctccttctgtagataagaagctgcagagcataagcattggccactctggtgttggc
agtatgacttcagtagaccgttgttcaaataatgatggcaaaactgaaaatcctgcagcc
tctcaaaacactatgctatctacagcacagaaaggtcctttatcccaaaatgatgatgct
actttgtcaactaaatcaaagcaagttgctttgagtgatcataaagagacatcttcacca
tgtcaatctgcatctcttatctcagcgagcggcaatcaaacaatggctaagatgtcattg
caggaaccaatgactggtggtgcatttaccaagctcggaaacaatacttctgttgcctca
cctatcgtgagtagtcctcctggactgtttggggcagaaaaacaaactttttgctctcaa
ccaactatatatgccaagcaaactttcaacgtgaataatacagacactggatttactgca
caaaatctcccaactaaggatggtattgtatcaaatggggtcatccctagcattagcagt
gggggtccaacttgcagtgagaaagtgaatgacttgacagaatctctgaaacgagatgac
agtgcagtgaaggaactttctatgagcaagaacaccatagtaccaggacttgaacaagtc
gatgttgaaaaacaagctgattcatgtaatggaagaatggctagaagggtggacacaaag
ccaactaaacttgtgagatatccagtagtgaacttctggcttggaccaagatcactgtta
ctaggttcacttaagctacaaaagaaaaagaagcacaagagaaccaaaagacgccatgca
gtttataaggacgtggaaattgctgactgttctggtgctaacaccaatgagcagcaggca
tcaacatcagcaactgtgtcatctgaaactgcacaatgtacacctcgtaagcggaaacat
tcctatgctagtgtaagttctgaaaatgataccgaagcattgaaaaagaggcagcaagtt
gttggagctagtgatgctggtgatcacaacatagatatcagaaaaagaaatagtgcaagt
tctggcggcgccgagcctccaaagatgggttcgagctcttatgcaaatcaagcacatcca
agaaacaatatagatgcaagcacgggagccacctcccaacatgttgctattcatttaaag
gacttgagcggagaagttactgttccatgctgggatgatgttggtgtgcggaacactgag
actggcgagtgcaaaagttcagggaggaggagcattggatatgtgttagatgaatgggat
gaggagtatgaccgcggaaagacaaagaaggtcagaaaagcgaaggaagacaactatgat
gggatgaaccccttccaggaggaggccaactctgtatctgatcgaaagacgagacgaaaa
gcgttccaagccagacttctgaacaagcctgccagatcacatcactag

DBGET integrated database retrieval system