KEGG   Brachypodium distachyon: 100826637Help
Entry
100826637         CDS       T01717                                 

Definition
cytochrome c-like
Orthology
K08738  
cytochrome c
Organism
bdi  Brachypodium distachyon
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100826637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 112 aa AA seqDB search
MASFSEAPPGNQATGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSSA
NKSMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKSATA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgttctcggaggcgcccccgggaaaccaagcgacgggcgagaagatcttcaag
accaagtgcgcgcagtgccacaccgtcgagaaaggcgccggccacaagcaagggcctaac
ctgaatggtctgtttgggaggcagtctggtacaactcctggttactcttactcttcggct
aacaagagtatggctgtgatttgggaggagaaaacattgtatgactacctgcttaatcca
aagaagtacattcctggaactaagatggtattccctggactgaagaagcctcaggagcgt
gctgatctcattgcatacctgaagagcgccacagcttga

DBGET integrated database retrieval system