KEGG   Brachypodium distachyon: 100826753Help
Entry
100826753         CDS       T01717                                 

Definition
(RefSeq) protoporphyrinogen oxidase, chloroplastic isoform X2
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00860  Porphyrin and chlorophyll metabolism
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
Module
bdi_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100826753
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     100826753
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     100826753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 FAD_oxidored Pyr_redox_2 FAD_binding_3 FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 100826753
NCBI-ProteinID: XP_003567497
UniProt: A0A0Q3G055
Position
2
AA seq 531 aa AA seqDB search
MATATMATAAATAAPPRRLRVPAPPRGGHARCAVASNATEAPAAPGARLSADCVIVGGGI
SGLCTAQALATKYGFGDVLVTEARARPGGNITTVERPDEGYLWEEGPNSFQPSDPVLTMA
VDSGLKDDLVFGDPNAPRFVLWEGKLRPVPSKPADLPFFDLMSIPGKLRAGLGALGIRPP
PPGREESVEEFVRRNLGAEVFERLIEPFCSGVYAGDPSKLSMRAAFGKVWRLEEIGGSII
GGTIKAIQDRGKNPKPPRDPRLPSPKGQTVASFRKGLAMLPNAIASRLGSKVKLSWKLTS
ITKLDNQGYLLAYETPEGVVSVQAKSVIMTIPSYVASDILRPLSGDAADALSRFYYPPVA
AVTVSYPKEAIRKECLIDGELQGFGQLHPRSQGVETLGTIYSSSLFPNRAPAGRVLLLNY
IGGATNTGIVSKTDSDLVEAVDRDLRKMLINPRAAEPLALGVRVWRQAIPQFLIGHLDRL
DAAKDALGRGGYDGLFLGGNYVAGVALGRCIEGAYESASQVSDFLTKYAYK
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgcaaccatggccacggctgccgccacagccgcgccgcctcgtcgcctccgt
gtccccgcgccgccccgcggcggccacgcgcgctgcgccgtcgcgagcaacgcgacggag
gctccggccgcgcccggcgcacggttgtccgcggactgcgtcatcgtgggcggcggtatc
agcggcctctgcaccgcacaggcgctggccaccaagtacggattcggcgacgtgctcgtc
acggaggcccgcgcccgtccaggcggaaacatcaccaccgtcgagcgccccgacgagggg
tacctctgggaggaggggcccaacagcttccagccctccgaccccgtcctcaccatggcc
gtggacagcgggctcaaggatgacttggtgttcggagacccgaacgctccacgtttcgtg
ctgtgggagggcaagctgaggccggtgccttccaagcccgccgacctgcctttcttcgac
ctcatgagcatacctgggaaactcagggctggccttggcgcgctcggcattcgcccgcct
cctccagggcgtgaggagtcggtggaggagtttgtgcgccgtaacctcggagcagaggtc
tttgagcgcctcatcgagcctttttgctcaggtgtgtacgctggtgacccttcaaagctc
agcatgagggctgcgtttgggaaggtgtggaggctggaggagattggtggtagcattatt
ggtggaaccatcaaagcaattcaggatagagggaagaatcccaaaccgcctagggatcct
cgacttccgtcacccaaggggcagactgttgcatctttcaggaagggtctagccatgctc
ccaaatgctattgcatctaggttgggtagtaaagtcaaactgtcatggaagcttacgagc
attacaaaattggacaaccagggatatttattagcatatgaaacaccagaaggagttgtt
tcagtgcaagctaaaagtgttattatgaccattccgtcatatgttgctagtgatattttg
cgcccactttcaggtgatgcagcagatgctctatcaagattttattatccaccagtggct
gctgtaactgtttcatatccaaaagaagctattaggaaagaatgcttaattgatggggag
ctccagggctttggtcagttacatccacgtagccaaggagttgagactttagggacaata
tatagctcttccctctttccaaatcgcgctccagctggaagggtgttacttctgaactac
attgggggtgctacaaatacagggatcgtttccaagactgacagcgatttggtagaagct
gttgatcgtgacctcaggaaaatgctgataaatcctagagcagcagaaccgttagcccta
ggtgttcgagtgtggcgacaagccataccacagttcctaattgggcaccttgaccgtctt
gatgctgccaaagatgccctgggccgaggtggctatgacggcttgttcctaggcggaaac
tatgtagcaggagttgccctgggccgatgcatcgagggtgcttatgagagtgcctcacaa
gtatctgacttcttaaccaagtatgcctacaagtaa

DBGET integrated database retrieval system