KEGG   Brachypodium distachyon: 100826753Help
Entry
100826753         CDS       T01717                                 

Definition
protoporphyrinogen oxidase, chloroplastic-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bdi  Brachypodium distachyon
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bdi00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 526 aa AA seqDB search
MATAAATAAPPRRLRVPAPPRGGHARCAVASNATEAPAAPGARLSADCVIVGGGISGLCT
AQALATKYGFGDVLVTEARARPGGNITTVERPDEGYLWEEGPNSFQPSDPVLTMAVDSGL
KDDLVFGDPNAPRFVLWEGKLRPVPSKPADLPFFDLMSIPGKLRAGLGALGIRPPPPGRE
ESVEEFVRRNLGAEVFERLIEPFCSGVYAGDPSKLSMRAAFGKVWRLEEIGGSIIGGTIK
AIQDRGKNPKPPRDPRLPSPKGQTVASFRKGLAMLPNAIASRLGSKVKLSWKLTSITKLD
NQGYLLAYETPEGVVSVQAKSVIMTIPSYVASDILRPLSGDAADALSRFYYPPVAAVTVS
YPKEAIRKECLIDGELQGFGQLHPRSQGVETLGTIYSSSLFPNRAPAGRVLLLNYIGGAT
NTGIVSKTDSDLVEAVDRDLRKMLINPRAAEPLALGVRVWRQAIPQFLIGHLDRLDAAKD
ALGRGGYDGLFLGGNYVAGVALGRCIEGAYESASQVSDFLTKYAYK
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggccacggctgccgccacagccgcgccgcctcgtcgcctccgtgtccccgcgccgccc
cgcggcggccacgcgcgctgcgccgtcgcgagcaacgcgacggaggctccggccgcgccc
ggcgcacggttgtccgcggactgcgtcatcgtgggcggcggtatcagcggcctctgcacc
gcacaggcgctggccaccaagtacggattcggcgacgtgctcgtcacggaggcccgcgcc
cgtccaggcggaaacatcaccaccgtcgagcgccccgacgaggggtacctctgggaggag
gggcccaacagcttccagccctccgaccccgtcctcaccatggccgtggacagcgggctc
aaggatgacttggtgttcggagacccgaacgctccacgtttcgtgctgtgggagggcaag
ctgaggccggtgccttccaagcccgccgacctgcctttcttcgacctcatgagcatacct
gggaaactcagggctggccttggcgcgctcggcattcgcccgcctcctccagggcgtgag
gagtcggtggaggagtttgtgcgccgtaacctcggagcagaggtctttgagcgcctcatc
gagcctttttgctcaggtgtgtacgctggtgacccttcaaagctcagcatgagggctgcg
tttgggaaggtgtggaggctggaggagattggtggtagcattattggtggaaccatcaaa
gcaattcaggatagagggaagaatcccaaaccgcctagggatcctcgacttccgtcaccc
aaggggcagactgttgcatctttcaggaagggtctagccatgctcccaaatgctattgca
tctaggttgggtagtaaagtcaaactgtcatggaagcttacgagcattacaaaattggac
aaccagggatatttattagcatatgaaacaccagaaggagttgtttcagtgcaagctaaa
agtgttattatgaccattccgtcatatgttgctagtgatattttgcgcccactttcaggt
gatgcagcagatgctctatcaagattttattatccaccagtggctgctgtaactgtttca
tatccaaaagaagctattaggaaagaatgcttaattgatggggagctccagggctttggt
cagttacatccacgtagccaaggagttgagactttagggacaatatatagctcttccctc
tttccaaatcgcgctccagctggaagggtgttacttctgaactacattgggggtgctaca
aatacagggatcgtttccaagactgacagcgatttggtagaagctgttgatcgtgacctc
aggaaaatgctgataaatcctagagcagcagaaccgttagccctaggtgttcgagtgtgg
cgacaagccataccacagttcctaattgggcaccttgaccgtcttgatgctgccaaagat
gccctgggccgaggtggctatgacggcttgttcctaggcggaaactatgtagcaggagtt
gccctgggccgatgcatcgagggtgcttatgagagtgcctcacaagtatctgacttctta
accaagtatgcctacaagtaa

DBGET integrated database retrieval system