KEGG   Brachypodium distachyon: 100826818Help
Entry
100826818         CDS       T01717                                 

Definition
ubiquitin carboxyl-terminal hydrolase 27-like
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100826818
Peptidases [BR:bdi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100826818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 501 aa AA seqDB search
MGRFEHGNLLVSLSDGNRHGYSLTAVAVVLGMAAAGLCKALHSSSVIPSWDFRKFFSGSE
RLYYSGGLENLGNNCFLNVILQALASCGHFVSSLDGLLVSDGALPEEQSEKMPLIFALSS
LLKDLSIVRGERTVLNPRRVMHALSFYVSHFNLTRQQDASEAFLHLLTSMRDEFSHCYVP
HRSSLADITMFPSKVYMQREGYEPECRRWIKNIFGPFDGTIGSTLSCRNCSSVLSLDFEN
FHCLPLSPVSDRDGDIINGCTLVDCLKHFTVLEHIDNYRCDHCWHSAAAKYFSRQSEVDE
EKVNKLRTCVDYDSCSCRHIFGPEKIAWTVSSKATKQLAITRCPKILCIHLLRASISLDG
ELIKREGHISFPLLLDLSPFAGGTFSNGHGPEPSAMNMQKYDQPSLHLYRQLNAQMPINI
SLSPSSSRNELYGLSAVIEHYGICGGGHYAAYRRVLSNSDTGDLVGPRRRHWLYVSDDHV
SQVSEGDVLAAEATLLFYERL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggtttgagcacggcaatctactggtatctcttagtgacggaaaccggcatggt
tatagtcttacagccgtagctgttgtactggggatggcagctgctgggttgtgcaaagcg
cttcatagcagttctgttataccatcatgggattttcggaagttcttttcaggatcagag
agactatactactctggaggcctggaaaatcttggcaataattgctttcttaatgttatc
ctgcaggcacttgcgagctgtggccattttgtgtcctctctagatggtttgcttgtaagt
gatggcgcactacctgaggaacagtctgagaaaatgcctcttatctttgctttaagttcc
cttttaaaagacttgagcatagttcgaggcgaaagaactgtactgaatcctcgaagagta
atgcatgctttgagcttctatgttagccacttcaatttgaccagacagcaggatgcttcg
gaagcttttcttcatctattgacatcaatgagggatgaattttcccattgttatgtaccg
cataggagctctctggcagacatcaccatgtttccctccaaagtatacatgcaaagggaa
ggttacgaacctgaatgcaggcgctggataaaaaacatatttggtccctttgatgggact
attggcagcacattatcttgcagaaattgttcatctgtgctgtcattggacttcgagaat
tttcactgcctgccgctctcacctgtttctgatagagatggagatattattaatgggtgt
actttggtggattgcctgaagcacttcactgtgctggagcatatcgacaattatcgttgt
gatcattgttggcatagtgctgctgccaaatatttctctcgtcagtcagaagtcgatgag
gaaaaggttaacaaactgcgcacctgtgtcgactatgacagttgtagttgcaggcacata
tttggtccggaaaaaatagcgtggacagtatcttcaaaagcaacgaagcagttggctatc
actcgttgtccgaagatcttgtgcattcatttgctacgtgcttctattagtctagatggt
gaactcataaagcgcgagggacacatttcttttcctttacttctcgatctatccccattt
gcaggaggcacattcagcaatggtcatggacctgaaccttcagcaatgaacatgcaaaaa
tatgaccagccatctctccatctgtatcgacaactaaatgcacagatgcccattaatatt
tctttatcaccatcctcatcaagaaatgagttatatggtctttcagctgtcattgagcac
tatggtatatgcggaggtgggcattatgcagcatacaggagagtactgtcaaattctgac
actggtgatctagtggggcctcgtcgcagacactggctttacgtctctgatgatcatgta
tcacaagtgtcagagggtgatgttttggctgcggaagccacactcctcttctacgaaaga
ctctag

DBGET integrated database retrieval system