KEGG   Brachypodium distachyon: 100827020Help
Entry
100827020         CDS       T01717                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
bdi  Brachypodium distachyon
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100827020
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100827020
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100827020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 932 aa AA seqDB search
MPRSKSTSGGSLFYRRKNSLRRDDLVSRSTLQLLDFDDGSPPEHAWRRKLSSHANRLKEF
NVTFREAFKMMKLGLRLWSYIREEASYGRKAPIDPFTRESTKPSASQGVPLGGMGTGSIS
RGFRGEFKHWQITPGSCEMLPVMENQFSIFIIRGSKKYSSVLAPGQHDGLKKSSNDGISS
WDWKLRGDRSTYHALFPRAWTVYDGEPDPELKVSCRQISPFIPHNYQESSLPTSVFVYTL
VNTGKERAKVSLVMTWANSIGGLSDHSGGHVNEPFIGENGVSGVLLHHKTANNNPPVTFA
VAACENQNVDVTVLPVFGLSGESSVTAREMWGTIVQDGCFDRDNFKAGPSMPSSLGETVC
AAVCASTWVEAHGRCTVVFALAWSSPEVKFKKGSTYHRRYTKFYGTSPRSAINLVQDALM
SYKHWEEEIDKWQTPILRDERLPEWYKITLFNELYFLVAGGTVWIDSESLMVDADKKVNS
SLPEDSDLPLHDSNCNSTVPLIDPMPLDFDDKENVGKFLYLEGVEYFMWCTYDVHFYASF
ALLNLFPKIELSIQRDFARAVLREDRSRVRFLADGTWGTRKVIGAVPHDLGAHDPWHELN
AYNIHDTSRWKDLNPKFVLQVYRDFAATGDMSFGKDVWPAVCTAMEYMEQFDRDGDGMIE
NDGFPDQTYDAWTVLGVSAYCGCLWLASLQAAAAMARGLGHNDYAERCMVKFAKAKHVFE
TKLWNGSYFNYDSGASYSSRSIQADQLAGQWYAASSGLPPLFDEGRIKCTLQKIFDYNVM
RVKGGRMGAVNGMYPNGKVDETCMQSREIWTGVTYSLAATMLLHGMEDQAFTTAEGIFLA
GWSEEGYGYWFQTPEAWTIDGHYRSLIYMRPLAIWAMQYALSPPKAILEAPKVNTMDRAH
ISPGALQFLQDSVRKITPKNGCFGSNVFNCDC
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcagcaagtccacctctggcggcagcttgttctaccgtaggaagaactcgttg
cggcgcgatgatctcgtcagcaggagcaccctgcagctgctggacttcgatgatggctca
ccaccagaacatgcttggagaaggaaattaagtagtcacgctaataggttgaaggagttc
aatgtaacatttagagaagcatttaaaatgatgaagcttggtctccgactttggtcatat
attcgggaagaagcttcttatggaaggaaagcgccaattgatccatttacaagagagagc
accaaaccgtcagcctcacaaggagtacctcttggtgggatggggactggtagcatatca
agaggttttagaggggaattcaagcattggcagataactcctggttcatgtgaaatgtta
ccagtaatggaaaaccaattttcgatctttataattagaggtagcaaaaagtactcctca
gttttagctcctggtcagcatgatggtttaaagaaatctagcaatgatggtatatcatcc
tgggattggaaattaagaggcgatcgttcaacataccatgctttatttcctcgagcatgg
actgtttatgatggtgaacctgatcctgaattgaaagtatcttgccgccaaatatctcca
tttattccccacaattatcaagagagcagtcttcctacctcagtttttgtctacactcta
gtcaatactggaaaggaaagggcaaaagtcagcctagtgatgacctgggcgaattctatt
ggggggctttcagatcactctggtggtcatgtaaatgagccattcataggagaaaatgga
gtttctggcgttcttctacatcacaagactgccaataacaatcctcctgtaacatttgct
gttgcggcatgtgaaaaccaaaatgtagatgtgacagtgttgcctgtttttgggctttct
ggagaaagctctgttacagcgagggaaatgtggggcacaattgttcaggatggttgcttt
gaccgagataatttcaaggctggccccagcatgccttcttcactgggcgaaacagtttgt
gcagcagtttgtgcttcaacctgggttgaagcacatggaagatgtacagttgtatttgcc
ttggcttggtcttctcccgaggttaaatttaagaagggaagtacataccacaggagatat
acaaagttttacggaacttctccaagatcggctataaacttggtgcaagatgccttgatg
agttataagcattgggaagaggaaattgataaatggcaaaccccaattcttcgtgacgag
aggcttccagagtggtacaaaattactctcttcaacgagctatacttcctagttgccgga
ggaactgtttggatagacagtgaatctttgatggttgatgctgataaaaaagtgaattca
agtctacctgaggacagtgatttgccacttcatgacagcaattgcaactctactgttcca
ctgattgatcctatgccacttgattttgatgacaaagaaaatgttgggaaatttttgtac
ctggaaggagtggagtacttcatgtggtgcacgtatgatgttcacttctacgcttctttt
gctcttttgaatctctttcccaagatcgagctgagcatccagcgtgattttgctagagct
gttttacgtgaagatagaagtagagtcagatttcttgctgatggtacctggggcactcgt
aaagtgattggtgctgttccccatgaccttggagcacatgatccttggcatgaattgaat
gcatacaatatacatgacacaagtagatggaaagatctcaatcccaagtttgtgctccag
gtttacagagattttgctgcaacaggtgacatgtcatttggcaaggatgtctggcctgca
gtttgtactgctatggaatacatggaacagtttgatcgtgatggtgatggcatgattgag
aatgatggatttcctgatcaaacttatgatgcttggacagttctaggtgtaagtgcctac
tgtggttgtctttggcttgcttcccttcaagccgcagccgcaatggctcgtggccttgga
cataatgattatgctgagaggtgcatggtgaaatttgcaaaagctaaacatgtatttgaa
accaagttatggaatggttcatattttaattatgatagtggagcaagttacagtagccgc
tctatccaggcagatcagttggctggacaatggtatgctgcatcatcgggcttgccacct
ctgtttgatgaaggcaggataaaatgcacgcttcagaaaatatttgactataatgtgatg
agggtaaaaggaggacgtatgggagcagtcaatggtatgtatccaaatggtaaggtagat
gaaacttgtatgcagtcgagggaaatctggactggagtaacctatagtttagctgcaaca
atgctgctccatggaatggaggatcaggctttcacgacagcggaaggcatttttcttgca
ggatggtctgaagagggctatgggtactggtttcaaactccagaagcatggacaattgat
ggccactatagatctctgatatatatgcgaccgctcgcaatatgggcaatgcagtatgcg
ttgtctcctccaaaggcgatacttgaggccccgaaggtaaatacaatggatagggcccac
atttctcctggcgcgctccagtttctccaggatagcgtcaggaagatcactcccaaaaat
gggtgctttggaagcaatgtatttaactgtgattgctga

DBGET integrated database retrieval system